DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and B3galt1

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001366253.1 Gene:B3galt1 / 26877 MGIID:1349403 Length:326 Species:Mus musculus


Alignment Length:348 Identity:97/348 - (27%)
Similarity:151/348 - (43%) Gaps:83/348 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LDPTKDTALIVPRHFCRSKALLTIAVCSYVH-HFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGR 132
            ::|.....||...:.|.......:.:.|..| .|:.|:|||:.||:..:|            || 
Mouse    58 INPHSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNF------------KG- 109

  Fly   133 YQDVLPERLKLYSEYLSGEGDSLRASIRLVFIVGRRNLASLLENEAVAIEAQKYNDVIQENFIDT 197
                                    ..|..:|::|:.  |..:.|:.|..|:|.::|:|.|:|||:
Mouse   110 ------------------------IKIATLFLLGKN--ADPVLNQMVEQESQIFHDIIVEDFIDS 148

  Fly   198 YNNLTIKAVMALKHITQSCLNTTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYE 262
            |:|||:|.:|.::.:...| :...:..|.|.|.|||:.|:::.||..:                 
Mouse   149 YHNLTLKTLMGMRWVATFC-SKAKYVMKTDSDIFVNMDNLIYKLLKPS----------------- 195

  Fly   263 VTSPRKRLTARREMMYGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLY 327
             |.||:|       .:.....|..|..:..:|||||..::....||.:..|:||:.|.||...:|
Mouse   196 -TKPRRR-------YFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIFSADVAELIY 252

  Fly   328 KASLGTRIVHLEDMFVTGLCAEKAGIKRTNHPLFRSSYPY--EGDEQCALKGSFTVHRAKDNVMW 390
            |.||.||::||||::| |||..|.||    ||...|.:.:  .....|..:...|||:.....|.
Mouse   253 KTSLHTRLLHLEDVYV-GLCLRKLGI----HPFQNSGFNHWKMAYSLCRYRRVITVHQISPEEMH 312

  Fly   391 EAWYRVTNFSSKCPPPQKDFHLR 413
            ..|   .:.|||       .|||
Mouse   313 RIW---NDMSSK-------KHLR 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 75/256 (29%)
B3galt1NP_001366253.1 Galactosyl_T 92..279 CDD:250845 75/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6002
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42774
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.