DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and pvg3

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_595999.1 Gene:pvg3 / 2540827 PomBaseID:SPBC1921.06c Length:378 Species:Schizosaccharomyces pombe


Alignment Length:326 Identity:74/326 - (22%)
Similarity:117/326 - (35%) Gaps:88/326 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LTIAVCSYVHHFERRRAIRKLWGNFTDFN-YSVFVKLHGHLKGRYQDVLPE---RLKLYSEYLSG 150
            |.:.:.|...:.:||..:|      ||:| |.....::..:..|:...|||   .|....|....
pombe    66 LYLGIFSQAKNVDRRNFLR------TDYNEYIKEFAVNDTVDVRFILGLPENEQELATIREEQRT 124

  Fly   151 EGD--------SLRASIRLV----FIVGRR--NLASLLENEAVAIEAQKYNDVIQENFIDTYNNL 201
            .||        ::.|...:|    |:.|.:  .|.|.|.:..:....|.:...|....|.||...
pombe   125 YGDLAVLPIPENVDAGKSIVYFQTFLEGYQPFPLFSELADNLIMPSTQFHGSFIYNQSIKTYELP 189

  Fly   202 TIKAVMAL---KHITQSCLNTTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEV 263
            .:|....|   ||       ...|..|.|||:|:|:|.:...|     ..:|..:.|::|     
pombe   190 GMKEFQDLGEPKH-------DYDFIVKADDDSFLNLPRLFEML-----KEHVGKSRFYFG----- 237

  Fly   264 TSPRKRLTARREMMYGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYK 328
                 |...|||:         |.|...               :| |:||..|::|.|:...:.|
pombe   238 -----RDCTRREL---------PTAVRD---------------FP-YMCGFFYIVSPDMAYEVAK 272

  Fly   329 ASLGTRIVHLED------MFVTGLCAEKAGIKRTNHPLFRSSYPYEG--DEQCALK-GSFTVHRA 384
            ..  ..|:..||      ::::|........|.|.:.|.   .|.||  ..|..|: .:..||:.
pombe   273 RR--NIIIPFEDAQTGYSIYLSGNVKNAEFSKCTLYDLI---LPNEGFNYRQSYLRIDAIAVHKL 332

  Fly   385 K 385
            |
pombe   333 K 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 63/283 (22%)
pvg3NP_595999.1 Galactosyl_T 103..282 CDD:304462 51/227 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.