DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and CG30036

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster


Alignment Length:392 Identity:214/392 - (54%)
Similarity:276/392 - (70%) Gaps:7/392 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IILAVFLAYRIFNFKPDPSKRTASLAGWSRDAPRSVADYLDPTKDTALIVPRHFCRSKALLTIAV 94
            ::|.::|:.|..   ||...|.|.|:||.|:.|..:.||||..|:|||||||.||:|||||.|||
  Fly     3 VLLLMYLSPRPV---PDVHDRKAELSGWEREKPLKIGDYLDQGKNTALIVPRDFCKSKALLVIAV 64

  Fly    95 CSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPERLKLYSEYLSGEGDSLRASI 159
            ||.:.|||:|.|||:.|||...|||..||:|||||:|:|..|:|.||||||.||||..|||.|.|
  Fly    65 CSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGRLKLYSMYLSGLDDSLTAKI 129

  Fly   160 RLVFIVGRRNLASLLENEAVAIEAQKYNDVIQENFIDTYNNLTIKAVMALKHITQSCLNTTAFYF 224
            |:|||:||....|..|.:.:..|:.::||:|||||:|:|:|||:|:|||||||:|||.:..||:.
  Fly   130 RIVFILGRSKNDSKRELDKLFRESIQHNDIIQENFVDSYHNLTLKSVMALKHISQSCADRAAFFL 194

  Fly   225 KCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARREMMYGRQHCNVPPAT 289
            ||||||||||||:||||||||||:...|.|:|...||:|.||..||...|.:|||.:.||:....
  Fly   195 KCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSPWNRLNGSRGLMYGHKFCNMKTVD 259

  Fly   290 NKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTRIVHLEDMFVTGLCAEKAGIK 354
            :..:.||||.|||:|..||:||.|:|||:|||||.|||..:|.|.:|||||:||||:||:||||:
  Fly   260 DVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEALTTSLVHLEDVFVTGICAKKAGIR 324

  Fly   355 RTNHPLFRSSYPYEGDEQCALKGSFTVHRAKDNVMWEAWYRVTNFSSKCPPPQKDF-HLRLPKMQ 418
            |.:.|||  :|.: |...|..||:.|:|....:.|.:||..|:|:|.||.||:|.| ...|.|..
  Fly   325 RRHQPLF--NYVH-GKPLCIFKGTITMHPVPLHSMLDAWAFVSNYSIKCLPPRKHFVKTELSKKS 386

  Fly   419 RC 420
            .|
  Fly   387 HC 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 151/256 (59%)
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 151/256 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438725
Domainoid 1 1.000 204 1.000 Domainoid score I6262
eggNOG 1 0.900 - - E1_KOG2287
Homologene 1 1.000 - - H81939
Inparanoid 1 1.050 329 1.000 Inparanoid score I4734
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0014368
OrthoInspector 1 1.000 - - otm24800
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - P PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
1211.800

Return to query results.
Submit another query.