DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and B3gnt7

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_660257.2 Gene:B3gnt7 / 227327 MGIID:2384394 Length:397 Species:Mus musculus


Alignment Length:450 Identity:107/450 - (23%)
Similarity:166/450 - (36%) Gaps:160/450 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YKAI-IILAVFLAYRIF-------NFKPDPSKRTASLAGWSRDAPRSVADYLDP------TKDTA 76
            ||:: :.||:.:|..:|       .|..||...|        ..|....:.::|      :||.|
Mouse     9 YKSVCLALALLVAVTVFQRSVTPGQFLQDPLPPT--------PGPAKTGNLVNPNSFWKSSKDVA 65

  Fly    77 L---IVPR-----------------------------HF---------------------CRSKA 88
            .   .|||                             ||                     |....
Mouse    66 APTPTVPRGPQVWDVITTNCSININLTHQPWFQSLEPHFRQFLAYRHCRYFPMLLNHPEKCAGDV 130

  Fly    89 LLTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPERLKLYSEYLS-GEG 152
            .:.:.|.|.:...:||..||:.||:                                |:.| |.|
Mouse   131 YMLVVVKSVITQHDRREVIRQTWGH--------------------------------EWESAGLG 163

  Fly   153 DSLRASIRLVFIVGRRNLASLLE-----NEAVAIEAQKYNDVIQENFIDTYNNLTIKAVMALKHI 212
               |.::|.:|::|   .||..|     .:.:|.|.:.|.|::|.:|:|::.|||:|.:..||.:
Mouse   164 ---RGAVRTLFLLG---TASKQEERTHYQQLLAYEDRLYADILQWDFLDSFFNLTLKEIHFLKWL 222

  Fly   213 TQSCLNTTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARREMM 277
            ...|.| ..|.||.|||.|||..|:|.||                    ....|::.|.....:.
Mouse   223 DIYCPN-VPFVFKGDDDVFVNPTNLLEFL--------------------SDRQPQENLFVGDVLK 266

  Fly   278 YGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTRIVHLEDMF 342
            :.|      |...|.||:|:|:.|:....||.|..|.|:|:|..:..:|:.|.....:..::|:|
Mouse   267 HAR------PIRKKDNKYYIPAVMYGKATYPPYAGGGGFLMSGSLARQLHHACDTLELFPIDDVF 325

  Fly   343 VTGLCAEKAGIKRTNHPLF--------RSSYPYEGDEQCALKGSFTVHR---AKDNVMWE 391
            : |:|.|..|:|.|.|..|        |||  ....|.|..:....||:   |:...||:
Mouse   326 L-GMCLEVLGVKPTGHEGFKTFGISRVRSS--RMNKEPCFYRAMLVVHKLLPAELLAMWD 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 72/262 (27%)
B3gnt7NP_660257.2 Galactosyl_T 144..338 CDD:304462 71/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42774
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.