DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and bre-2

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001255189.1 Gene:bre-2 / 189753 WormBaseID:WBGene00000267 Length:400 Species:Caenorhabditis elegans


Alignment Length:302 Identity:75/302 - (24%)
Similarity:116/302 - (38%) Gaps:71/302 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TALIVPRHFCRSKALLTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPE 139
            |.|.:| :|..:..:|.| |.|...:|.||..:||.|.|                        ||
 Worm   116 TWLHLP-NFLENSEILMI-VSSNCDNFARRNILRKTWMN------------------------PE 154

  Fly   140 RLKLYSEYLSGEGDSLRASIRLVFIVGRRNLASLLENEAVAIEAQKYNDVIQENFIDTYNNLTIK 204
                 :..:.|:|     .::.:|:||.......| |..|..||:.:.|:|..:..|.|.||:.|
 Worm   155 -----NSQIIGDG-----RMKALFLVGINGADEKL-NAVVLEEAKVFGDMIVIDLEDNYLNLSYK 208

  Fly   205 AVMALKHITQSCLNTTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKR 269
            .:..|.: :.|...:.....|.|:|.......:...:...||..:..:.   ||..||       
 Worm   209 TISLLLY-SISKTKSPNLIGKIDEDVLFYPDQLTPLINDKTINTSTFSI---YGEKYE------- 262

  Fly   270 LTARREMMYGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTR 334
              |...:.:|..:.          ||.:....|:..|||.||.|..|.|:.....|:.:|:...:
 Worm   263 --AGVAVNHGEDNA----------KWQISKNSFKCSVYPSYLSGPTYFLTRKAAKRIVEATKHRK 315

  Fly   335 I--VHLEDMFVTGLCAEKAGIKRTNHPLF---------RSSY 365
            .  |.:||:|:|||.|...|||:...|..         |.||
 Worm   316 FISVDVEDVFITGLLAGDVGIKKNQLPFMYMIEEATNDRESY 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 62/258 (24%)
bre-2NP_001255189.1 Galactosyl_T 141..342 CDD:250845 62/258 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.