DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and F48F7.3

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_510324.2 Gene:F48F7.3 / 185989 WormBaseID:WBGene00009849 Length:359 Species:Caenorhabditis elegans


Alignment Length:344 Identity:65/344 - (18%)
Similarity:113/344 - (32%) Gaps:122/344 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 LPERLKLYSEYLSGEGDSLRASIR----------------------LVFI-----------VGRR 168
            :|.|..::..|| |.|..::::.|                      |:.:           :.|.
 Worm    47 MPPRHYIHPVYL-GSGPPIQSTPRPLYNPRRVKTSARLDCHLQNKTLIIVNSHANHTKYREMQRE 110

  Fly   169 NL--ASLLENEAVAI-------------EAQKYNDVIQENFIDTYNNLTIKAVMALKHITQSCLN 218
            |.  |.|.||.||..             |.:.|.|:||.:..:.|:|:|.||:..:..|.: |.:
 Worm   111 NFGPAWLNENNAVMYFIVGTDIDVDIDDEIKTYEDIIQVDINENYHNITYKAIFWINEINK-CRH 174

  Fly   219 TTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARREMMYGRQHC 283
            ......|.|||..:::.. |.||:                         ||.:...:.|..|...
 Worm   175 GPKLLLKIDDDVHIDMIG-LQFLI-------------------------KRYSVMDDFMACRVIS 213

  Fly   284 NVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTRIVHLEDMFVT---- 344
            |.....|..:|||:....::......|..|..|.:|.:::|.|:.....::.:.::|.:||    
 Worm   214 NGQVVRNNTSKWYLSKKDYKFPNLGTYCQGMVYFISGNLLPILHGNIEKSQFLWMDDWYVTRSLV 278

  Fly   345 -------------------------GLCAEKAGIKRTNHPLFRSSYPYEGDEQCALKGSFTVHRA 384
                                     .|.|.|....||....||...            .|.::|.
 Worm   279 GDYKISYYSLEQHSISPNTVREVYSSLMAIKTRKWRTIFAHFRPPQ------------KFPMYRR 331

  Fly   385 KDNVMWEAWYRVTNFSSKC 403
            :     :.|..:|..::.|
 Worm   332 R-----KIWANITEINNSC 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 58/298 (19%)
F48F7.3NP_510324.2 Galactosyl_T 107..289 CDD:250845 45/208 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.