DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and bre-5

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001255612.1 Gene:bre-5 / 178142 WormBaseID:WBGene00000270 Length:322 Species:Caenorhabditis elegans


Alignment Length:338 Identity:69/338 - (20%)
Similarity:126/338 - (37%) Gaps:96/338 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SVADYLDPTKDTALIVPRHF-----CR----SKALLTIAVCSYVHHFERRRAIRKLWGNFTDFNY 119
            |..|:..|.:...|.:...|     |:    .:.::.|.:.|...:...|.::||.||       
 Worm    44 SFGDFSWPLETRNLQLRSKFTKYPQCKFSGNGQKIIIIIIKSSAKNGPMRESVRKTWG------- 101

  Fly   120 SVFVKLHGHLKGRYQDVLPERLKLYSEYLSGEGDSLRASIRLVFIVGRRNLASLLEN----EAVA 180
             ||..:.|      .:|:|                       :|||||      :||    ..:.
 Worm   102 -VFRMIDG------VEVMP-----------------------IFIVGR------VENMEIMRRID 130

  Fly   181 IEAQKYNDVIQENFIDTYNNLTIKAVMALKHIT--QSCLNTTAFYFKCDDDTFVNVPNILHFLLG 243
            :|::||.|::..:.||:|.|.|:|...|:.:..  ..| ::..|.|..|||..|::||::.|   
 Worm   131 VESEKYKDILAISDIDSYRNNTLKLFGAIDYAANPNQC-SSPDFTFLVDDDYLVHIPNLVKF--- 191

  Fly   244 GTIPVNVVTAGFHYGNTYEVTSPRKRLTARREMMYGRQHCNVPPATNKLNKWYMPSYMFRGGVYP 308
                                    .:...:.|::|.....:..|...|::|..:....:....||
 Worm   192 ------------------------AKTKQKEELVYEGFVFDTSPFRLKIHKHSISLNEYPFSRYP 232

  Fly   309 RYLCGSGYLLSIDVVPRLYKASLGTRIVHLEDMFVTGLCAEKAGIKRTNHPLF----RSSYPYEG 369
            .|:......|:.:.:.|...:....::...:|:| ||:.|:...:..|::..|    |.....|.
 Worm   233 PYVSAGAVFLTSETIARFRNSIRKLKMFPFDDVF-TGILAKTVNVAATHNENFIFWCRRVSQKEW 296

  Fly   370 DEQCALKGSFTVH 382
            |:     |...||
 Worm   297 DD-----GVIAVH 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 54/262 (21%)
bre-5NP_001255612.1 Galactosyl_T 93..282 CDD:304462 54/260 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100261
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.