DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and bus-2

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001255233.1 Gene:bus-2 / 176977 WormBaseID:WBGene00044618 Length:329 Species:Caenorhabditis elegans


Alignment Length:366 Identity:80/366 - (21%)
Similarity:132/366 - (36%) Gaps:128/366 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RIVARIWLFIRRYKAIIILAVFLAYR-------IFNFKPDPSKRTASLAGWSRDAPRSVADYLDP 71
            ||....:||:   ..:|.|..|..:.       |||.:.||:....:|           :..|.|
 Worm     6 RIPVLAYLFL---SCLIALYAFKFHLSTLVDGIIFNNEDDPTPFDFAL-----------SFQLKP 56

  Fly    72 TKDTALIVPRHFCRSKALLTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDV 136
            .....|..|.        :.:.|.:....||.|..:||.|.|:|.                    
 Worm    57 ELPDELPAPN--------VLVLVTTIASEFEMRNQVRKSWANYTS-------------------- 93

  Fly   137 LPERLKLYSEYLSGEGDSLRASIRLVFIVGRRNLASLLENEAVAIEAQKYNDVIQENFIDTYNNL 201
                                .::|:.|::|   :.:..:...:..|:|::||:|..:..:.|.:|
 Worm    94 --------------------NAVRVKFLMG---IPADKQLPLIQKESQEFNDLIIADLDEGYYSL 135

  Fly   202 TIKAVMALKHITQ-----SCLNTTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTY 261
            ..|.:..|.:.|:     .||      .|.|.|..:.:.|                        |
 Worm   136 ASKTMAMLIYKTRYYPDTKCL------VKADVDNVLILRN------------------------Y 170

  Fly   262 EVTSPRKRL--TARREMMYGRQHCNVP-PATNKLNKWYMPSYMFRGGVYPRYLCGSG-YLLSIDV 322
            |      ||  .|...::.|:  |:|. .......||.:|.:::...|||.| |.:| |:|:...
 Worm   171 E------RLCEEAVAPLILGK--CDVSRTVLRNTTKWAVPEFVYSEPVYPTY-CSTGTYVLAGKT 226

  Fly   323 VPR-LYKASLGTRIVH-------LEDMFVTGLCAEKAGIKR 355
            ||: |.|.::.:...:       .||:..||:.||||||||
 Worm   227 VPQSLIKEAMSSPFANSLNFRKLSEDVIFTGILAEKAGIKR 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 61/271 (23%)
bus-2NP_001255233.1 Galactosyl_T 81..269 CDD:304462 60/269 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.