DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and B3GALNT2

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_006711812.1 Gene:B3GALNT2 / 148789 HGNCID:28596 Length:586 Species:Homo sapiens


Alignment Length:265 Identity:62/265 - (23%)
Similarity:106/265 - (40%) Gaps:56/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 YLSGEGDSLRASI-----RLVFIVGRRNLASLLENEAVAIEAQKYNDVIQENFIDTYNNLTIKAV 206
            |...|||:|..::     ||:..:  |||..  |:..:..|:..|:|::..:.:|||.|:..|  
Human   277 YTIQEGDALLHNLHSRPQRLIDHI--RNLHE--EDALLKEESSIYDDIVFVDVVDTYRNVPAK-- 335

  Fly   207 MALKHITQSCLNTTAF--YFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKR 269
              |.:..:..:.||:|  ..|.|||.::::..:.:.:    :..|:....|.:||.        |
Human   336 --LLNFYRWTVETTSFNLLLKTDDDCYIDLEAVFNRI----VQKNLDGPNFWWGNF--------R 386

  Fly   270 LTARREMMYGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTR 334
            |..               |.::..||....|  ....||.:.|||||::|.|:|..|...|...:
Human   387 LNW---------------AVDRTGKWQELEY--PSPAYPAFACGSGYVISKDIVKWLASNSGRLK 434

  Fly   335 IVHLEDMFVTGLCAEKAGIKRTNHPLFRSSYPYEGDEQCALKGSFTVHRAKDNVMWEAWYRVTNF 399
            ....||:.: |:.....|.||....|:..       |:....|..:..:.....:.|.|    ..
Human   435 TYQGEDVSM-GIWMAAIGPKRYQDSLWLC-------EKTCETGMLSSPQYSPWELTELW----KL 487

  Fly   400 SSKCP 404
            ..:||
Human   488 KERCP 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 55/218 (25%)
B3GALNT2XP_006711812.1 Galactosyl_T 307..457 CDD:304462 44/183 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.