DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and B3gnt5

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001152879.1 Gene:B3gnt5 / 108105 MGIID:2137302 Length:376 Species:Mus musculus


Alignment Length:328 Identity:87/328 - (26%)
Similarity:145/328 - (44%) Gaps:71/328 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LIVPRHFCRSK-ALLTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPER 140
            ||..|..|::: .||.:.:.:...::.||.||||.|||                           
Mouse    74 LINHREKCQAQDVLLLLFIKTAPENYGRRSAIRKTWGN--------------------------- 111

  Fly   141 LKLYSEYLSGEGDSLRASIRLVFIVGRRNLASLLENEAVAI-EAQKYNDVIQENFIDTYNNLTIK 204
                ..|:..:   |.|:|:::|.:|........|.:...| |.|.|.|:||::|||:::|||.|
Mouse   112 ----ENYVQSQ---LNANIKILFALGTPGPLKGKELQKRLIGEDQVYKDIIQQDFIDSFHNLTSK 169

  Fly   205 AVMALKHITQSCLNTTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKR 269
            .::........|.: ..|....|||.|:::||::.:|.|      :...|.              
Mouse   170 FLLQFSWANTFCPH-AKFLMTADDDIFIHMPNLIEYLQG------LEQIGV-------------- 213

  Fly   270 LTARREMMYGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKAS--LG 332
                |:...|..|...||..:|.:|:|:|..|::...||.|..|:.|::|.||..::|:||  |.
Mouse   214 ----RDFWIGHVHRGGPPVRDKSSKYYVPYEMYKWPAYPDYTAGAAYVVSRDVAAKIYEASQTLN 274

  Fly   333 TRIVHLEDMFVTGLCAEKAGIKRTNHPLF--RSSYPYEGDEQCALKGSFTVHRAKDNVMWEAWYR 395
            :. ::::|:|: ||||.|.||...:|..|  ....||   ..|..:...|.|....::. :.|..
Mouse   275 SS-MYIDDVFM-GLCANKVGILPQDHVFFSGEGKIPY---HPCIYEKMMTSHGHLQDLQ-DLWIE 333

  Fly   396 VTN 398
            .|:
Mouse   334 ATH 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 72/259 (28%)
B3gnt5NP_001152879.1 Galactosyl_T 101..297 CDD:419759 72/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42774
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.