DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and B3GNT2

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001306004.1 Gene:B3GNT2 / 10678 HGNCID:15629 Length:397 Species:Homo sapiens


Alignment Length:373 Identity:94/373 - (25%)
Similarity:160/373 - (42%) Gaps:87/373 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 DPSKRTASLAGWSRDAPRSVAD---YLDPTKDTALIVPRHFCRSKALLTIAVCSYVHHFERRRAI 107
            :|..|..|:.....:.|....|   ||.....:.||.....|..|..|.:|:.|...||.||:||
Human    97 EPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAI 161

  Fly   108 RKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPERLKLYSEYLSGEGDSLRASIRLVFIVGRR---- 168
            |:.||.                                     |.::...::..||::|:.    
Human   162 RESWGQ-------------------------------------ESNAGNQTVVRVFLLGQTPPED 189

  Fly   169 ---NLASLLENEAVAIEAQKYNDVIQENFIDTYNNLTIKAVMALKHITQSCLNTTAFYFKCDDDT 230
               :|:.:|:     .|::|:.|::..|:.||:.||::|.|:.|:.::.||.: |.|.||.|||.
Human   190 NHPDLSDMLK-----FESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPD-TEFVFKGDDDV 248

  Fly   231 FVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARREMMYGRQHCNVPPATNKLNKW 295
            |||..:||::|                      .|..|  |..:::..|....|..|..:|..|:
Human   249 FVNTHHILNYL----------------------NSLSK--TKAKDLFIGDVIHNAGPHRDKKLKY 289

  Fly   296 YMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTRIVHLEDMFVTGLCAEKAGIKRTNHPL 360
            |:|..:: .|:||.|..|.|:|.|..:..|||..:....:..::|:: ||:|.:|.|:....|..
Human   290 YIPEVVY-SGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVY-TGMCLQKLGLVPEKHKG 352

  Fly   361 FRSSYPYEGDEQ-----CALKGSFTVHRAKDNVMWEAWYRVTNFSSKC 403
            ||:   ::.:|:     |:......||..|...|.:.|.::.:...||
Human   353 FRT---FDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 66/263 (25%)
B3GNT2NP_001306004.1 Galactosyl_T 156..345 CDD:389837 65/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.