DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and b3galt5.4

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_002938781.1 Gene:b3galt5.4 / 100494986 XenbaseID:XB-GENE-1013344 Length:350 Species:Xenopus tropicalis


Alignment Length:414 Identity:102/414 - (24%)
Similarity:153/414 - (36%) Gaps:118/414 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RLVDELKRLYRIVARIWLFIRRYKAIIILAVFLAYRIFNFKP----------DPSKRTASLAGWS 58
            ||:|.....:.:..: |:|.   ..::|........:.|.:.          .||.|:|::    
 Frog    27 RLIDGFNSQWMLRLK-WIFA---TMLLIFCFGFCVLLLNLQDFCTICGKIFYSPSLRSATV---- 83

  Fly    59 RDAPRSVADYLDPTKDTALIVPRHFC-RSKALLTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVF 122
                          ::|..:.|:..| |:...|.:.|.:.....|.|..||:.||.         
 Frog    84 --------------RETFQLRPKIQCERNPPFLVLLVTTTHSQKEERNVIRQTWGK--------- 125

  Fly   123 VKLHGHLKGRYQDVLPERL---KLYSEY-LSGEGDSLRASIRLVFIVGRRNLASLLENEAVAIEA 183
                            |||   ||.|.| |.|.|.:..                 |:.|.:. |:
 Frog   126 ----------------ERLIGDKLVSSYFLLGAGTNPH-----------------LQGELIE-ES 156

  Fly   184 QKYNDVIQENFIDTYNNLTIKAVMALKHITQSCLNTTAFYFKCDDDTFVNVPNILHFLLGGTIPV 248
            ..|||:||.:|||||.|||:|.:|.::.|...|..|| |..|.|.|.|||...::..|:      
 Frog   157 NTYNDIIQRDFIDTYYNLTLKTIMGVEWICTYCPQTT-FVMKTDTDMFVNTLYLVELLI------ 214

  Fly   249 NVVTAGFHYGNTYEVTSPRKRLTARREMMYGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCG 313
                              :|..|.  :...|....:..|..:..:|||:....|.|..||.:..|
 Frog   215 ------------------KKNQTT--DFFTGSLRLDDGPVRDINSKWYINEKEFPGTKYPPFCSG 259

  Fly   314 SGYLLSIDVVPRLYKASLGTRIVHLEDMFVTGLCAEKAGIKRTN---HPLFR-SSYPYEGDEQCA 374
            :||:.|:||..::...|.......|||:|| |:|.||..|...|   .|.|. ...|:   ..|.
 Frog   260 TGYVFSVDVAQKIQNVSSTVPFFKLEDVFV-GMCLEKVKINLQNLHTEPTFHIYKKPF---TVCN 320

  Fly   375 LKGSFTVHRAKDN---VMWEAWYR 395
            .:...|.|..:..   :.|||..|
 Frog   321 YRKLVTSHGVRPRELYLYWEALRR 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 75/263 (29%)
b3galt5.4XP_002938781.1 Galactosyl_T 116..304 CDD:304462 74/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4358
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9490
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.