DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and b3galt5.2

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_012813706.2 Gene:b3galt5.2 / 100494668 XenbaseID:XB-GENE-992036 Length:311 Species:Xenopus tropicalis


Alignment Length:358 Identity:92/358 - (25%)
Similarity:139/358 - (38%) Gaps:98/358 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PSKRTASLAGWSRDAPRSVADYLDPTKDTALIVPRHFC-RSKALLTIAVCSYVHHFERRRAIRKL 110
            ||.|:|::                  ::|..:.|:..| |:...|.:.|.:.....|.|..||:.
 Frog    37 PSLRSATV------------------RETFQLRPKVQCERNPPFLVLLVTTNHSQKEERNVIRQT 83

  Fly   111 WGNFTDFNYSVFVKLHGHLKGRYQDVLPERL---KLYSEY-LSGEGDSLRASIRLVFIVGRRNLA 171
            ||.                         |||   ||.|.| |.|.|.:.|               
 Frog    84 WGK-------------------------ERLIGDKLVSTYFLLGAGTNPR--------------- 108

  Fly   172 SLLENEAVAIEAQKYNDVIQENFIDTYNNLTIKAVMALKHITQSCLNTTAFYFKCDDDTFVNVPN 236
              |:.|.:. |:..|||:||.:|||:|.|||:|.:|.::.|...|..|| |..|.|.|.|||...
 Frog   109 --LQEELIE-ESNTYNDIIQRDFIDSYYNLTLKTIMGIEWICTHCPQTT-FVMKTDTDMFVNPLY 169

  Fly   237 ILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARREMMYGRQHCNVPPATNKLNKWYMPSYM 301
            ::..|:                        :|..|.  ::..|....:..|..:..:|||:.:..
 Frog   170 LVELLV------------------------KKNQTT--DLFTGSLRLHDAPIRDINSKWYISTAE 208

  Fly   302 FRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTRIVHLEDMFVTGLCAEKAGIKRTNHPLFRSSYP 366
            :....||.:..|:||:.|:||..|:...|.......|||::| |:|.||..|...|.....:.|.
 Frog   209 YPQAKYPPFCSGTGYVFSVDVAQRIQNVSSTVPFFKLEDVYV-GMCLEKLEINLQNLHTETTFYA 272

  Fly   367 YEGD-EQCALKGSFTVHRAKDN---VMWEAWYR 395
            |:.. ..|..:...|.|..:..   :.|||..|
 Frog   273 YKKPFTVCNYRKLVTSHGVQPGEIYLFWEALRR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 73/260 (28%)
b3galt5.2XP_012813706.2 Galactosyl_T 77..265 CDD:419759 72/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4358
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9490
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.