DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and b3galt4

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_002938731.1 Gene:b3galt4 / 100489366 XenbaseID:XB-GENE-919694 Length:346 Species:Xenopus tropicalis


Alignment Length:379 Identity:99/379 - (26%)
Similarity:148/379 - (39%) Gaps:105/379 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LFIRRYKAIIILAVFLAYRIFNFKPDPSKRTASLAGWSRDAPRSVADYLDPTKDTALIVPRHFCR 85
            :|...|:.||..|:.|.|        |::           :|.|...:..|   ..|:.|...|.
 Frog    34 VFSEHYEEIISCALPLFY--------PTR-----------SPPSTTPFKPP---AILLSPPKACS 76

  Fly    86 SKALLTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPERLKLYSEYLSG 150
            ...:|.|.|.|...|.|||.|||:.||:                                   |.
 Frog    77 PAPMLLILVSSAPFHHERRNAIRQTWGS-----------------------------------SS 106

  Fly   151 EGDSLRASIRLVFIVG----RRNLASLLENEAVAIEAQKYNDVIQENFIDTYNNLTIKAVMALKH 211
            ..||...:.   |::|    ..:.|:|||      ||:.:.|:||..|.|:|.|||:|.::.|..
 Frog   107 NLDSQAVTF---FVLGVPQSHNDQAALLE------EAKIHGDIIQAAFNDSYRNLTMKTLVGLSW 162

  Fly   212 ITQSCLNTTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARREM 276
            ::|.| :...|..|.|||.|||..::..:|.|            .:|..|               
 Frog   163 MSQRC-HGARFLLKTDDDVFVNTFSLSRYLQG------------QHGPLY--------------- 199

  Fly   277 MYGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTRIVHLEDM 341
             .||.|..|.|..:..::.|..:.::....:..|..|:||:||.:||..|.:.:..:.|:.|||:
 Frog   200 -LGRVHWKVYPNRDPDSRHYTSTDIYPEKYFSPYCSGTGYILSHEVVEWLLQQTGKSPIIPLEDV 263

  Fly   342 FVTGLCAEKAGIKRTNHPLFRSS--YPYEGDEQCALKGSFTVHRAKDNVMWEAW 393
            :| ||.|..|||...:......|  .|:.|   |.....|:.|......|.|||
 Frog   264 YV-GLLAWAAGISPKHSASMSGSMKIPHNG---CCYSTMFSSHGLTPKGMKEAW 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 70/260 (27%)
b3galt4XP_002938731.1 Galactosyl_T 93..278 CDD:389837 70/258 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9490
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.