DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and b3galt8

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_001343419.2 Gene:b3galt8 / 100003996 ZFINID:ZDB-GENE-131127-583 Length:325 Species:Danio rerio


Alignment Length:373 Identity:91/373 - (24%)
Similarity:157/373 - (42%) Gaps:90/373 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ARIWLFIRRYKAIIILAVFLAYRIFNFKPDPSKRTASLAGWSRDAPRSVADY--LDPTKDTALIV 79
            :|..||.....|.:|..||.|:....|.|       |:.|   ::|.|...|  :.|:....::.
Zfish     5 SRFKLFTYLALAGLITLVFFAFNSLVFDP-------SVPG---NSPISKELYKVISPSTYRFILN 59

  Fly    80 PRHFCRSKA-LLTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPERLKL 143
            ....|..|. .|.:.:...:...|.|.|||:.||                     ||.|      
Zfish    60 QPEVCEKKTPFLILMIPVTLKDAEARTAIRRTWG---------------------QDGL------ 97

  Fly   144 YSEYLSGEGDSLRASIRLVFIVGRRNLASLLENEAVAIEAQKYNDVIQENFIDTYNNLTIKAVMA 208
                :.|      .||..:|:||:...:..:..|.:..|::::.|:||.:|:|:|.|||||.:|.
Zfish    98 ----VPG------VSILHLFVVGQPARSDPVLQEHLQKESKEHGDIIQMDFVDSYQNLTIKTMMI 152

  Fly   209 LKHITQSCLNTTAFY-FKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTA 272
            :..:...|  .:|:| .|.|.|.|:||..::.:|.|                         :..:
Zfish   153 MNWVATYC--QSAWYAMKIDADIFLNVHYLVDYLHG-------------------------QGES 190

  Fly   273 RREMMYGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTRIVH 337
            |::.:.|....:..|..:.:||||:...::....||.|:.|:.|:.|.|:..::..||...:.:.
Zfish   191 RKDYITGSVISDAIPHRDSINKWYISEDLYPKSWYPPYVSGAAYVFSTDLAGKISWASRFVQPIP 255

  Fly   338 LEDMFVTGLCAEKAGIKRTNHPLFRSSYPYEGDEQCALKGSFTVHRAK 385
            |||::| |||.:..|:|    |::.:.:       ..|:..|.|.|.|
Zfish   256 LEDVYV-GLCLDVLGVK----PVYATQF-------LGLRNLFEVRRLK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 66/257 (26%)
b3galt8XP_001343419.2 Galactosyl_T 83..273 CDD:328824 66/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592640
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24800
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.