DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and B3gnt9

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001258844.1 Gene:B3gnt9 / 97440 MGIID:2142841 Length:399 Species:Mus musculus


Alignment Length:395 Identity:99/395 - (25%)
Similarity:147/395 - (37%) Gaps:117/395 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PRPVPDVHDRKAELSGWEREKPL----------------KIGDYL---DQGKNTALIVPRDFCKS 56
            |||.|.:  |..||....|..||                ..|.||   ||.:...||..|..|:|
Mouse    48 PRPTPSL--RARELPNTARAAPLAYEGDTPVPPTPTDPFDFGGYLRAKDQRRFPLLINQRRKCRS 110

  Fly    57 KAL------LVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGRLKLYS 115
            ...      |:|||.|....||:|.|:|||||            ..|.::|              
Mouse   111 DGASGGSPDLLIAVKSVAADFERREAVRQTWG------------AEGRVQG-------------- 149

  Fly   116 MYLSGLDDSLTAKIRIVFILGRSKNDSK---------RELDKLFRESIQHNDIIQENFVDSYHNL 171
                       |.:|.||:||..|....         |.|  |..||..:.||:...|.|::.||
Mouse   150 -----------ALVRRVFLLGVPKGAGSGGAGTRSHWRTL--LEAESRAYADILLWAFEDTFFNL 201

  Fly   172 TLKSVMALKHISQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSP 236
            |||.:..|...|..|.| ..|..|.|.|.||:|.|||.||                    :::.|
Mouse   202 TLKEIHFLSWASAFCPD-VHFVFKGDADVFVHVRNLLQFL--------------------ELRDP 245

  Fly   237 WNRLNGSRGLMYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEAL 301
                  ::.|:.|......:.:....|.:::|..::....||.|..|.|:::|...::||.....
Mouse   246 ------AQDLLAGDVIVQARPIRARASKYFIPRAVYGLPVYPAYAGGGGFVLSGATLRRLADACS 304

  Fly   302 TTSLVHLEDVFVTGICAKKAGIRRRHQPLFN-----------YVHGKPLCIFKGTITMHPVPLHS 355
            ...|..::|||: |:|.::..:.....|.|.           ::.....|.::..:.:|.:   |
Mouse   305 QVELFPIDDVFL-GMCLQRLRLTPEPHPAFRTFGISQPSAAPHLRTFDPCFYRELVVVHGL---S 365

  Fly   356 MLDAW 360
            ..|.|
Mouse   366 AADIW 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 66/265 (25%)
B3gnt9NP_001258844.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..55 4/8 (50%)
Galactosyl_T 132..331 CDD:389837 66/265 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.