DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and B3GALT2

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_003774.1 Gene:B3GALT2 / 8707 HGNCID:917 Length:422 Species:Homo sapiens


Alignment Length:313 Identity:87/313 - (27%)
Similarity:141/313 - (45%) Gaps:70/313 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 CKSKA-LLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGRLKLYSMY 117
            |:.|: .|::.:.:.....|.|.||||||||.                    |:.|| :::..::
Human   146 CQEKSPFLILLIAAEPGQIEARRAIRQTWGNE--------------------SLAPG-IQITRIF 189

  Fly   118 LSGLDDSLTAKIRIVFILGRSKNDSKRELDKLFRESIQHNDIIQENFVDSYHNLTLKSVMALKHI 182
            |.||      .|::...|.|:          :..||.|::||||:.::|:|:|||:|::|.:..:
Human   190 LLGL------SIKLNGYLQRA----------ILEESRQYHDIIQQEYLDTYYNLTIKTLMGMNWV 238

  Fly   183 SQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTI-PLYKDTVGYHSRTTYKVKSPWNRLNGSRGL 246
            :..| ....:.:|.|.|.|||...|::.||...: |.:....||                    |
Human   239 ATYC-PHIPYVMKTDSDMFVNTEYLINKLLKPDLPPRHNYFTGY--------------------L 282

  Fly   247 MYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEALTTSLVHLEDV 311
            |.|:.....|     .|.||||..::...:||.:.|||||:.|.|:.::::..:|....:|||||
Human   283 MRGYAPNRNK-----DSKWYMPPDLYPSERYPVFCSGTGYVFSGDLAEKIFKVSLGIRRLHLEDV 342

  Fly   312 FVTGICAKKAGIRRRHQP---LFNYVH-GKPLCIFKGTITMHPVPLHSMLDAW 360
            :| |||..|..|.....|   :||:.. ....|.:...||.|......::..|
Human   343 YV-GICLAKLRIDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYW 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 76/257 (30%)
B3GALT2NP_003774.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..110
Galactosyl_T 165..359 CDD:250845 76/257 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.