DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and AT1G74800

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_177618.2 Gene:AT1G74800 / 843819 AraportID:AT1G74800 Length:672 Species:Arabidopsis thaliana


Alignment Length:382 Identity:82/382 - (21%)
Similarity:129/382 - (33%) Gaps:135/382 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFVLLLMYLSPRPVPDVHDRKAELS-GWEREKPLKIGDYLDQGKNTALIVPRDFCKSKALLVIAV 64
            :||..|....|...|..|   .||| .|:                 |.:||    .....:.|.:
plant   389 VFVASLPTSHPSFAPQRH---LELSKRWQ-----------------APVVP----DGPVEIFIGI 429

  Fly    65 CSGLDHFEQRSAIRQTWGNTKSFNYGE-----FVRLHGHLEGKYLSVMPGRLKLYSMYLSGLDDS 124
            .|..:||.:|.|:|::|.........:     ||.|||                           
plant   430 LSAGNHFSERMAVRKSWMQHVLITSAKVVARFFVALHG--------------------------- 467

  Fly   125 LTAKIRIVFILGRSKNDSKRELD-KLFRESIQHNDIIQENFVDSYHNLTLKSVMALKHISQSCAD 188
                              ::|:: :|.:|:....||:...::|||..:.||:|...:|  .:.|.
plant   468 ------------------RKEVNVELKKEAEYFGDIVLVPYMDSYDLVVLKTVAICEH--GALAF 512

  Fly   189 RAAFFLKCDDDTFVNVPNLLHFLLGGTI----------PLYKDTVGYHSRTTYKVKSPWNRLNGS 243
            .|.:.:||||||||.        ||..|          .||...:.|:.:.          |.|.
plant   513 SAKYIMKCDDDTFVK--------LGAVINEVKKVPEGRSLYIGNMNYYHKP----------LRGG 559

  Fly   244 RGLMYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLY--AEALTTSLV 306
            :                    |.:.|..:....||.|.:|.||::|.|:.:.:.  .|.....|.
plant   560 K--------------------WAVTYEEWPEEDYPPYANGPGYVLSSDIARFIVDKFERHKLRLF 604

  Fly   307 HLEDVFVTGICAKKAGIRRRHQPLFNYVHGKPLCIF---KGTITMHPVPLHSMLDAW 360
            .:|||.| |:..:.  .:....|: :|.|....|.|   :...|.|......|:..|
plant   605 KMEDVSV-GMWVEH--FKNTTNPV-DYRHSLRFCQFGCVENYYTAHYQSPRQMICLW 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 56/274 (20%)
AT1G74800NP_177618.2 PLN03133 35..672 CDD:215596 82/382 (21%)
Gal-bind_lectin 192..389 CDD:278752 82/382 (21%)
Galactosyl_T 439..616 CDD:304462 56/262 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1111
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.