DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and AT1G33430

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001185130.1 Gene:AT1G33430 / 840236 AraportID:AT1G33430 Length:403 Species:Arabidopsis thaliana


Alignment Length:340 Identity:72/340 - (21%)
Similarity:120/340 - (35%) Gaps:114/340 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DRKAELSGWEREKPLKIGDYLDQGKNTALIVPRDFCKSKALLVIAVCSGLDHFEQRSAIRQTWGN 83
            ||.:|.  |...          ..||.:.:       .|...||.:.:.....::|.::||||..
plant   104 DRSSEF--WSER----------SAKNQSRL-------QKVFAVIGINTAFSSKKRRDSVRQTWMP 149

  Fly    84 T----KSF--NYGEFVRLHGHLEGKYL---SVMPGRLKLYSMYLSGLDDSLTAKIRIVFILGRSK 139
            |    |..  ..|..||..|.|..:::   |..||.:                            
plant   150 TGEKLKKIEKEKGIVVRKFGFLFDRFVIGHSATPGGV---------------------------- 186

  Fly   140 NDSKRELDK-LFRESIQHNDIIQENFVDSYHNLTLKSVMALKHISQSCADRAAFFLKCDDDTFVN 203
                  ||| :..|..:|.|.::...::.||.|:.|:  .|...:.:....|.|::|.|||..||
plant   187 ------LDKAIDEEDSEHKDFLRLKHIEGYHQLSTKT--RLYFSTATAMYDAEFYVKVDDDVHVN 243

  Fly   204 VPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSPWNRLNGSRGLMYGHKFCNMKTVDDVKSPWYMP 268
            :..|:..|           ..|.||....:           |.|......:.|.|     .::.|
plant   244 LGMLVTTL-----------ARYQSRPRIYI-----------GCMKSGPVLSQKGV-----KYHEP 281

  Fly   269 -YYMF--KGAKYPKYLSGTGYLMSIDVVKRLYAEALTTS--LVHL---EDVFVTGICAKKAGIRR 325
             ::.|  :|.||.::.:|..|.:|.|:     |..::|:  ::|.   |||   .:.|...|:..
plant   282 EFWKFGEEGNKYFRHATGQIYAISKDL-----ATYISTNQGILHRYANEDV---SLGAWMLGLEV 338

  Fly   326 RHQPLFNYVHGKPLC 340
            .|      |..:.:|
plant   339 EH------VDERSMC 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 61/274 (22%)
AT1G33430NP_001185130.1 PLN03193 7..401 CDD:178735 72/340 (21%)
DUF4094 7..103 CDD:290073
Galactosyl_T 138..342 CDD:304462 61/280 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.