DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and B3GNT5

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_114436.1 Gene:B3GNT5 / 84002 HGNCID:15684 Length:378 Species:Homo sapiens


Alignment Length:331 Identity:95/331 - (28%)
Similarity:154/331 - (46%) Gaps:68/331 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LIVPRDFCKSK-ALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGR 110
            ||..::.|::: .||::.|.:..:::::||.||:||||.   ||   ||                
Human    76 LINHKEKCQAQDVLLLLFVKTAPENYDRRSGIRRTWGNE---NY---VR---------------- 118

  Fly   111 LKLYSMYLSGLDDSLTAKIRIVFILGRSKNDSKRELD-KLFRESIQHNDIIQENFVDSYHNLTLK 174
                        ..|.|.|:.:|.||........||. ||..|..::|||||::||||::|||||
Human   119 ------------SQLNANIKTLFALGTPNPLEGEELQRKLAWEDQRYNDIIQQDFVDSFYNLTLK 171

  Fly   175 SVMALKHISQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSPWNR 239
            .:|.....:..| ..|.|.:..|||.|:::|||:.:|              .|.....|:..|  
Human   172 LLMQFSWANTYC-PHAKFLMTADDDIFIHMPNLIEYL--------------QSLEQIGVQDFW-- 219

  Fly   240 LNGSRGLMYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLY--AEALT 302
                    .|........:.|..|.:|:.|.|::...||.|.:|..|::|.||..::|  ::.|.
Human   220 --------IGRVHRGAPPIRDKSSKYYVSYEMYQWPAYPDYTAGAAYVISGDVAAKVYEASQTLN 276

  Fly   303 TSLVHLEDVFVTGICAKKAGIRRRHQPLFNYVHGKPL--CIFKGTITMHPVPLHSMLDAWAFVSN 365
            :|| :::|||: |:||.|.||..:....|:.....|.  ||::..:|.|. .|..:.|.|...::
Human   277 SSL-YIDDVFM-GLCANKIGIVPQDHVFFSGEGKTPYHPCIYEKMMTSHG-HLEDLQDLWKNATD 338

  Fly   366 YSIKCL 371
            ..:|.:
Human   339 PKVKTI 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 79/259 (31%)
B3GNT5NP_114436.1 Galactosyl_T 102..299 CDD:389837 79/257 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6776
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.