DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and AT1G27120

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_174032.2 Gene:AT1G27120 / 839601 AraportID:AT1G27120 Length:673 Species:Arabidopsis thaliana


Alignment Length:318 Identity:75/318 - (23%)
Similarity:113/318 - (35%) Gaps:103/318 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGE-----FVRLHGHLEGKYLSVMPGRLKLYSMYLS 119
            |.|.:.|..:||.:|.|:|::|...|.....:     ||.||...|                   
plant   427 LFIGILSAGNHFAERMAVRKSWMQQKLVRSSKVVARFFVALHARKE------------------- 472

  Fly   120 GLDDSLTAKIRIVFILGRSKNDSKRELDKLFRESIQHNDIIQENFVDSYHNLTLKSVMALKHISQ 184
                     :.:         |.|:|.:       ...||:...::|.|..:.||:|...::...
plant   473 ---------VNV---------DLKKEAE-------YFGDIVIVPYMDHYDLVVLKTVAICEYGVN 512

  Fly   185 SCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSPWNRLNGSRGLMYG 249
            :.|  |.:.:||||||||.|..::                   :...|||       |...|..|
plant   513 TVA--AKYVMKCDDDTFVRVDAVI-------------------QEAEKVK-------GRESLYIG 549

  Fly   250 HKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLY--AEALTTSLVHLEDVF 312
            :...|.|.:...|  |.:.:..:....||.|.:|.||::|.||.|.:.  .|.....|..:|||.
plant   550 NINFNHKPLRTGK--WAVTFEEWPEEYYPPYANGPGYILSYDVAKFIVDDFEQKRLRLFKMEDVS 612

  Fly   313 VTGICAKKAGIRRRHQPLFN------YVHGKPLCIFKGTI----TMHPVPLHSMLDAW 360
            : |:..:|          ||      .||....|.| |.|    |.|......|:..|
plant   613 M-GMWVEK----------FNETRPVAVVHSLKFCQF-GCIEDYFTAHYQSPRQMICMW 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 58/263 (22%)
AT1G27120NP_174032.2 Gal-bind_lectin 187..391 CDD:278752
Galactosyl_T 439..619 CDD:304462 57/254 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1111
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.