DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and DD46

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_564154.1 Gene:DD46 / 838806 AraportID:AT1G22015 Length:398 Species:Arabidopsis thaliana


Alignment Length:252 Identity:56/252 - (22%)
Similarity:92/252 - (36%) Gaps:85/252 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KSKALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGRLKLYSMYLS 119
            |:|..:||.:.:.....::|.::|:||                         ||...||      
plant   123 KNKVFMVIGINTAFSSRKRRDSLRETW-------------------------MPQGEKL------ 156

  Fly   120 GLDDSLTAKIRIV--FILGRSKNDSK---RELDKLFRESIQHNDIIQENFVDSYHNLTLKSVMAL 179
               :.|..:..||  |::|.|...:.   :|:|.   |..|:||..:.:.|:.|:||:.|:    
plant   157 ---EKLEKEKGIVVKFMIGHSSTPNSMLDKEIDS---EDAQYNDFFRLDHVEGYYNLSAKT---- 211

  Fly   180 KHISQSCADR--AAFFLKCDDDTFVNVPNLLHFLL--------------GGTIPLYKDTVGYHSR 228
            |....|...:  |.|::|.|||..||:..|...|.              .|.: |.|.|..|...
plant   212 KSFFSSAVAKWDAEFYVKIDDDVHVNLGTLASTLASHRSKPRVYIGCMKSGPV-LTKKTAKYREP 275

  Fly   229 TTYKVKSPWNR-LNGSRGLMYG----------------HKFCNMKTVDDVK-SPWYM 267
            ..:|.....|: ...:.|.:|.                ||:.|    :||. ..|::
plant   276 EFWKFGEEGNKYFRHATGQIYAISKDLATYISNNQPILHKYAN----EDVTLGSWFI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 52/235 (22%)
DD46NP_564154.1 PLN03193 5..393 CDD:178735 56/252 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.