DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and AT5G62620

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_201068.1 Gene:AT5G62620 / 836383 AraportID:AT5G62620 Length:681 Species:Arabidopsis thaliana


Alignment Length:314 Identity:71/314 - (22%)
Similarity:119/314 - (37%) Gaps:94/314 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGE-----FVRLHGHLEGKYLSVMPGRLKLYSMYLS 119
            :.|.:.|..:||.:|.|:|::|...|.....:     ||.||                       
plant   434 MFIGILSAGNHFAERMAVRRSWMQHKLVKSSKVVARFFVALH----------------------- 475

  Fly   120 GLDDSLTAKIRIVFILGRSKNDSKRELD-KLFRESIQHNDIIQENFVDSYHNLTLKSVMALKHIS 183
                                  |::|:: :|.:|:....||:...::|||..:.||:|...::.:
plant   476 ----------------------SRKEVNVELKKEAEFFGDIVIVPYMDSYDLVVLKTVAICEYGA 518

  Fly   184 QSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSPWNRLNGSRGLMY 248
            ...|  |.|.:||||||||.|..:|                     :...|:|.:|......:.|
plant   519 HQLA--AKFIMKCDDDTFVQVDAVL---------------------SEAKKTPTDRSLYIGNINY 560

  Fly   249 GHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSID----VVKRLYAEALTTSLVHLE 309
            .||...       :..|.:.|..:....||.|.:|.||::|.|    :||......|  .:..:|
plant   561 YHKPLR-------QGKWSVTYEEWPEEDYPPYANGPGYILSNDISRFIVKEFEKHKL--RMFKME 616

  Fly   310 DVFVTGICAKKAGIRRRHQPLFNYVHGKPLCIF---KGTITMHPVPLHSMLDAW 360
            ||.| |:..::  .....:|: :|:|....|.|   :..:|.|......|:..|
plant   617 DVSV-GMWVEQ--FNNGTKPV-DYIHSLRFCQFGCIENYLTAHYQSPRQMICLW 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 58/266 (22%)
AT5G62620NP_201068.1 PLN03133 126..681 CDD:215596 71/314 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1111
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.