DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and AT5G53340

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_568791.1 Gene:AT5G53340 / 835415 AraportID:AT5G53340 Length:338 Species:Arabidopsis thaliana


Alignment Length:278 Identity:69/278 - (24%)
Similarity:108/278 - (38%) Gaps:89/278 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ELSGWEREKPLKIGDYLDQGKNTALIVPRDFCKSKALLVIAVCSGLDHFEQRSAIRQTWGNTKSF 87
            |||...:|..:.....|..|..|         |.:.|:||.:.:.|.:.::|.|:||.|..|   
plant    84 ELSSARQEGFVSKSPKLADGTET---------KKRPLVVIGIMTSLGNKKKRDAVRQAWMGT--- 136

  Fly    88 NYGEFVRLHGHLEGKYLSVMPGRLKLYSMYLSGLDDSLTAKIRIVFILGRS--KNDSKRELDK-L 149
                         |..|.      ||.|      :..:.|:    |::|||  |.||   :|| :
plant   137 -------------GASLK------KLES------EKGVIAR----FVIGRSANKGDS---MDKSI 169

  Fly   150 FRESIQHND-IIQENFVDSYHNLTLKSVMALKHISQSCADR--AAFFLKCDDDTFVNVPNLLHFL 211
            ..|:.|.:| ||.::.|::....:.|    :|......|||  |.|:.|..|:.:||:..|    
plant   170 DTENSQTDDFIILDDVVEAPEEASKK----VKLFFAYAADRWDAQFYAKAIDNIYVNIDAL---- 226

  Fly   212 LGGTIPLYKDTVGYHSRTTYKVKSPWNRLNGSRGLMYGHKFCNMKTVDDVKSP---WYMPYYMFK 273
              ||      |:..|             |...|..:    .| ||:.:....|   ||.|.:...
plant   227 --GT------TLAAH-------------LENPRAYI----GC-MKSGEVFSEPNHKWYEPEWWKF 265

  Fly   274 GAK--YPKYLSGTGYLMS 289
            |.|  |.::..|..|:::
plant   266 GDKKAYFRHAYGEMYVIT 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 57/229 (25%)
AT5G53340NP_568791.1 DUF4094 17..91 CDD:290073 3/6 (50%)
Galactosyl_T 124..320 CDD:304462 57/229 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.