DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and AT4G32120

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_194939.1 Gene:AT4G32120 / 829344 AraportID:AT4G32120 Length:345 Species:Arabidopsis thaliana


Alignment Length:311 Identity:68/311 - (21%)
Similarity:110/311 - (35%) Gaps:104/311 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLMYLSPRP-VPDVHDRKAELSGWEREKPL----------KIGDYLDQGKNTALIVPRDFCKSK 57
            :|.|....|| |..|.|:...|...:.|:.:          |...||.:.|:.:      ....|
plant    59 VLKMNYDQRPKVLTVEDKLVVLGCKDLERRIVETEMELAQAKSQGYLKKQKSVS------SSGKK 117

  Fly    58 ALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGRLKLYSMYLSGLD 122
            .|.||.|.:|.....:|:..|.:|                         ||            .|
plant   118 MLAVIGVYTGFGSHLKRNKFRGSW-------------------------MP------------RD 145

  Fly   123 DSL----TAKIRIVFILGRSKN--DS-KRELDKLFRESIQHNDIIQENFVDSYHNLTLKSVMALK 180
            |:|    ...:.|.|::|||.|  || .|::|:..|.:  .:.:|.||..::...|..|    :|
plant   146 DALKKLEERGVVIRFVIGRSANRGDSLDRKIDEENRAT--KDFLILENHEEAQEELPKK----VK 204

  Fly   181 HISQSCADR--AAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSPWNRLNGS 243
            ....:....  |.|::|.||:..::        |.|.|.|.:                      |
plant   205 FFYSAAVQNWDAEFYVKVDDNVDLD--------LEGMIALLE----------------------S 239

  Fly   244 RGLMYGHKFCNMKTVDDVK---SPWYMP-YYMFKGAK-YPKYLSGTGYLMS 289
            |....|.....||:.|.:.   |.||.| ::.|...| |.::.:|:..::|
plant   240 RRSQDGAYIGCMKSGDVITEEGSQWYEPEWWKFGDDKSYFRHATGSLVILS 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 49/232 (21%)
AT4G32120NP_194939.1 DUF4094 24..102 CDD:290073 10/42 (24%)
Galactosyl_T 134..328 CDD:304462 49/230 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.