DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and AT4G26940

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_567762.1 Gene:AT4G26940 / 828801 AraportID:AT4G26940 Length:407 Species:Arabidopsis thaliana


Alignment Length:254 Identity:55/254 - (21%)
Similarity:93/254 - (36%) Gaps:77/254 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VPRDFCKSKALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGRLKL 113
            :|....|.|.|:|:.|.:.....::|.::|.||     ...||        |.|.|....|    
plant   130 LPETVTKRKYLMVVGVNTAFSSRKRRDSVRATW-----MPPGE--------ERKKLEEEKG---- 177

  Fly   114 YSMYLSGLDDSLTAKIRIVFILGRSKNDSKRELDKLFR-ESIQHNDIIQENFVDSYHNLTLKSVM 177
                           |.:.|::|.|.... ..||:..: |..:|.|.::.:.|:.|..|:.|:  
plant   178 ---------------IVMRFVIGHSSTPG-GILDRAIQAEESKHGDFLRLDHVEGYLELSAKT-- 224

  Fly   178 ALKHISQSCA--DRAAFFLKCDDDTFVNVPNL--------------LHFLLGGTIPLYKDTVGYH 226
             ..:.:.:.|  | |.|::|.|||..||:..|              :..:..|.: |.:..|.||
plant   225 -KTYFTTAFAMWD-ADFYVKVDDDVHVNIATLGAELARYRMKPRVYIGCMKSGPV-LAQKGVRYH 286

  Fly   227 SRTTYKVKSPWNR-LNGSRGLMYG----------------HKFCNMKTVDDVK-SPWYM 267
            ....:|.....|: ...:.|.:|.                ||:.|    :||. ..|::
plant   287 EPEYWKFGEEGNKYFRHATGQLYAISRELASYISINQNVLHKYVN----EDVSLGSWFL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 49/231 (21%)
AT4G26940NP_567762.1 PLN03193 1..407 CDD:178735 55/254 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.