DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and AT4G21060

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_193838.2 Gene:AT4G21060 / 827853 AraportID:AT4G21060 Length:741 Species:Arabidopsis thaliana


Alignment Length:310 Identity:63/310 - (20%)
Similarity:118/310 - (38%) Gaps:86/310 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGRLKLYSMYLSGLDDS 124
            |.:.|.|..:||.:|.|:|:||....|....:.|...      ::::.|                
plant   495 LFMGVLSATNHFSERMAVRKTWMQHPSIKSSDVVARF------FVALNP---------------- 537

  Fly   125 LTAKIRIVFILGRSKNDSKRELDKLFRESIQH-NDIIQENFVDSYHNLTLKSVMALKHISQSCAD 188
                              ::|::.:.::..:: .||:...|:|.|..:.||::...:...|:.. 
plant   538 ------------------RKEVNAMLKKEAEYFGDIVILPFMDRYELVVLKTIAICEFGVQNVT- 583

  Fly   189 RAAFFLKCDDDTFVNVPNLLHFLLGGTIP---LYKDTVGYHSRTTYKVKSPWNRLNGSRGLMYGH 250
             |.:.:|||||||:.|.::|. .:.|..|   ||...:....|.                     
plant   584 -APYIMKCDDDTFIRVESILK-QIDGVSPEKSLYMGNLNLRHRP--------------------- 625

  Fly   251 KFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAE--ALTTSLVHLEDVFV 313
                ::|     ..|.:.:..:..|.||.|.:|.||::|.::.|.:.::  .....|..:|||.:
plant   626 ----LRT-----GKWTVTWEEWPEAVYPPYANGPGYIISSNIAKYIVSQNSRHKLRLFKMEDVSM 681

  Fly   314 TGICAKKAGIRRRHQPLFNYVHGKPLCIFKGTI---TMHPVPLHSMLDAW 360
             |:..::  .....||: .|.|....|.:..|:   |.|......|:..|
plant   682 -GLWVEQ--FNASMQPV-EYSHSWKFCQYGCTLNYYTAHYQSPSQMMCLW 727

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 48/262 (18%)
AT4G21060NP_193838.2 Gal-bind_lectin 250..461 CDD:278752
Galactosyl_T 509..686 CDD:304462 48/250 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1111
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.