DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and AT2G25300

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_180102.3 Gene:AT2G25300 / 817068 AraportID:AT2G25300 Length:346 Species:Arabidopsis thaliana


Alignment Length:385 Identity:82/385 - (21%)
Similarity:138/385 - (35%) Gaps:111/385 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PRPVPDVHDRKAELSGWER--EKP------------LKIGDYLDQGKNTALIVPRDFCKS----- 56
            |..||...:|:|..|.:.:  .||            |.:...|.|.....:::.....||     
plant     5 PTTVPSKSERRARSSKFSQSSSKPSVIMAFFSCVAWLYVAGRLWQDAENRVVLNNILKKSYDQKP 69

  Fly    57 KAL-----LVIAVCSGLD----HFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGRLK 112
            |.|     |::..|..|:    ..|....:.::.|..|:..       .|...||.|..:.|   
plant    70 KVLTVDDKLMVLGCKDLERRIVETEMELTLAKSQGYLKNLK-------SGSSSGKKLLAVIG--- 124

  Fly   113 LYSMYLSGL------------DDSL----TAKIRIVFILGRSKN--DSKRELD-KLFRESIQHND 158
            :||.:.|.|            .|:|    ...|.|.|::|||.|  ||   || |:..|:....|
plant   125 VYSGFGSHLRRNTFRGSYMPQGDALRKLEERGIVIRFVIGRSPNRGDS---LDRKIDEENQARKD 186

  Fly   159 -IIQENFVDSYHNLTLKSVMALKHISQSCADR--AAFFLKCDDDTFVNVPNLLHFLLGGTIPLYK 220
             :|.||..::...|..|    :|....:....  |.|::|.||:..:::..|:..|         
plant   187 FLILENHEEAQEELAKK----VKFFFSAAVQNWDAEFYIKVDDNIDLDLEGLIGLL--------- 238

  Fly   221 DTVGYHSRTTYKVKSPWNRLNGSRGLMYGHKFCNMKT---VDDVKSPWYMP-YYMFKGAK-YPKY 280
                 .||               ||....:..| ||:   |.:....||.| ::.|...| |.::
plant   239 -----ESR---------------RGQDAAYIGC-MKSGEVVAEEGGKWYEPEWWKFGDEKSYFRH 282

  Fly   281 LSGTGYLMSIDVVKRLYAEALTTSLVHLEDVFVTGICAKKAGIRRRHQPLFNYVHGKPLC 340
            .:|:..::|..:.:.:...:.:......:|   |.|.:...|::.      .|:....||
plant   283 AAGSLLILSKTLAQYVNINSGSLKTYAFDD---TSIGSWMIGVQA------TYIDDNRLC 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 61/283 (22%)
AT2G25300NP_180102.3 DUF4094 30..103 CDD:290073 11/72 (15%)
Galactosyl_T 134..329 CDD:304462 50/240 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.