DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and B3GNT4

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_110392.1 Gene:B3GNT4 / 79369 HGNCID:15683 Length:378 Species:Homo sapiens


Alignment Length:342 Identity:92/342 - (26%)
Similarity:155/342 - (45%) Gaps:76/342 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KNTALIVPRDFCKSKALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVM 107
            :|.::::....|.....|::|:.|...|.|:|:|||.|||           |:.|...|:     
Human   103 RNFSILLEPSGCSKDTFLLLAIKSQPGHVERRAAIRSTWG-----------RVGGWARGR----- 151

  Fly   108 PGRLKLYSMYLSGLDDSLTAKIRIVFILGRSKNDSKRELDKLFRESIQHNDIIQENFVDSYHNLT 172
                                ::::||:||.:.:....:|  |..||.:.:||:|.:|.:.:.|||
Human   152 --------------------QLKLVFLLGVAGSAPPAQL--LAYESREFDDILQWDFTEDFFNLT 194

  Fly   173 LKSVMALKHISQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSPW 237
            ||.:...:.:..:| .:|.|.||.|||.||:|||:|.||.|                       |
Human   195 LKELHLQRWVVAAC-PQAHFMLKGDDDVFVHVPNVLEFLDG-----------------------W 235

  Fly   238 NRLNGSRGLMYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEALT 302
               :.::.|:.|..........:.|..:::|..|::...||.|..|.||:||...|:||.|....
Human   236 ---DPAQDLLVGDVIRQALPNRNTKVKYFIPPSMYRATHYPPYAGGGGYVMSRATVRRLQAIMED 297

  Fly   303 TSLVHLEDVFVTGICAKKAGIRRRHQPLF-NYVHGKPL-----CIFKGTITMHPVPLHSMLDAWA 361
            ..|..::|||| |:|.::.|:...|...| .:...:||     |:::|.:.:|.:....|...||
Human   298 AELFPIDDVFV-GMCLRRLGLSPMHHAGFKTFGIRRPLDPLDPCLYRGLLLVHRLSPLEMWTMWA 361

  Fly   362 FVSNYSIKC----LPPR 374
            .|::..:||    :|.|
Human   362 LVTDEGLKCAAGPIPQR 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 72/256 (28%)
B3GNT4NP_110392.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..81
Galactosyl_T 132..321 CDD:304462 71/254 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H81939
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.