DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and B3galt2

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001102962.1 Gene:B3galt2 / 686081 RGDID:1586615 Length:422 Species:Rattus norvegicus


Alignment Length:376 Identity:95/376 - (25%)
Similarity:151/376 - (40%) Gaps:100/376 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RPVPDVHDRKAELS-----GWEREKPLKIGDYLDQGKN-------TALIVPRDFCKSKA-LLVIA 63
            ||....:....|||     |.|.........|.::|..       ..:|...:.|:.|: .|::.
  Rat    92 RPQTATNSNNTELSPQGVTGLENTLSANGSIYNEKGTGHPNSYHFKYIINEPEKCQEKSPFLILL 156

  Fly    64 VCSGLDHFEQRSAIRQTWGN---------TKSFNYGEFVRLHGHLEGKYLSVMPGRLKLYSMYLS 119
            :.:.....|.|.||||||||         |:.|..|..::|:|:|:                   
  Rat   157 IAAEPGQIEARRAIRQTWGNETLAPGIQITRIFLLGISIKLNGYLQ------------------- 202

  Fly   120 GLDDSLTAKIRIVFILGRSKNDSKRELDKLFRESIQHNDIIQENFVDSYHNLTLKSVMALKHISQ 184
                                       ..:..||||::||||:.::|:|:|||:|::|.:..::.
  Rat   203 ---------------------------HAIQEESIQYHDIIQQEYLDTYYNLTIKTLMGMNWVAT 240

  Fly   185 SCADRAAFFLKCDDDTFVNVPNLLHFLLGGTI-PLYKDTVGYHSRTTYKVKSPWNRLNGSRGLMY 248
            .| ....:.:|.|.|.|||...|:|.||...: |.:....||                    ||.
  Rat   241 YC-PHTPYVMKTDSDMFVNTEYLIHKLLKPDLPPRHNYFTGY--------------------LMR 284

  Fly   249 GHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEALTTSLVHLEDVFV 313
            |:.....|     .|.||||..::...:||.:.|||||:.|.|:.::::..:|....:|||||:|
  Rat   285 GYAPNRNK-----DSKWYMPPDLYPSERYPVFCSGTGYVFSGDLAEKIFKVSLGIRRLHLEDVYV 344

  Fly   314 TGICAKKAGIRRRHQP---LFNYVH-GKPLCIFKGTITMHPVPLHSMLDAW 360
             |||..|..:.....|   :||:.. ....|.:...||.|......::..|
  Rat   345 -GICLAKLRVDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYW 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 74/266 (28%)
B3galt2NP_001102962.1 Galactosyl_T 165..359 CDD:250845 74/266 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44835
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.