DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and b3galt1b

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_009298719.1 Gene:b3galt1b / 571003 ZFINID:ZDB-GENE-130530-770 Length:331 Species:Danio rerio


Alignment Length:386 Identity:117/386 - (30%)
Similarity:176/386 - (45%) Gaps:95/386 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LMYLS-PRPVPDVHDRKAELSGWEREKP--LKIGDYLDQGK-NTALIVPRDF---------CKSK 57
            |.||| .||.....:   :||...|:.|  ||.......|. .|..:.|..|         |::.
Zfish    20 LWYLSISRPTSSYVN---QLSAPARKTPKTLKSNATTTFGNIRTRPLNPHGFDFIINEPKKCETN 81

  Fly    58 A-LLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGRLKLYSMYLSGL 121
            . .|||.:.:....|:.|.|||:|||                                       
Zfish    82 VPFLVILITTTHKEFDARQAIRETWG--------------------------------------- 107

  Fly   122 DDSLTAKIRIV--FILGRSKNDSKRELDKLFRESIQHNDIIQENFVDSYHNLTLKSVMALKHISQ 184
            |:|..:.:||:  |:||||.:....::  :.:||...:||:.|:|:|||||||||::|.::.::.
Zfish   108 DESTFSDLRIITLFLLGRSTDVVLNQM--VEQESEIFHDIVVEDFIDSYHNLTLKTLMGMRWVAT 170

  Fly   185 SCADRAAFFLKCDDDTFVNVPNLLHFLL-GGTIPLYKDTVGYHSRTTYKVKSPWNRLNGSRGLMY 248
            .| ::|.:.:|.|.|.|||:.||::.|| ..|.|..:...||             .:||.     
Zfish   171 FC-NQAKYVMKTDSDIFVNMDNLVYKLLKPATKPRRRYFTGY-------------VINGG----- 216

  Fly   249 GHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEALTTSLVHLEDVFV 313
                    .:.|::|.||||..::..:|||.:.|||||:.|.||.:.:|..:|.|.|:|||||:|
Zfish   217 --------PIRDMRSKWYMPRDLYPESKYPPFCSGTGYVFSADVAELIYKTSLHTRLLHLEDVYV 273

  Fly   314 TGICAKKAGIRRRHQPLFNYVHGK---PLCIFKGTITMHPVPLHSMLDAW-AFVSNYSIKC 370
             |:|.:|.||.......||  |.|   .||.::..||:|.:....|...| ...|...:||
Zfish   274 -GVCLRKLGIHPYQNSGFN--HWKMAYSLCRYRRVITVHQISPEEMHRIWNDMTSKKHLKC 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 82/259 (32%)
b3galt1bXP_009298719.1 Galactosyl_T 97..287 CDD:250845 82/258 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.