DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and b3gnt3.4

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001103580.1 Gene:b3gnt3.4 / 561172 ZFINID:ZDB-GENE-030131-8875 Length:386 Species:Danio rerio


Alignment Length:426 Identity:101/426 - (23%)
Similarity:175/426 - (41%) Gaps:127/426 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLLLMYLSPRPVPDVHDRKAELSGWEREKPLKIGDYLD-------QGKNTAL------------- 47
            |.||:.::.      :|.|.|:....:||..|:.|..|       |..:|..             
Zfish    17 VCLLIIINK------NDSKEEVKEKSKEKHEKLHDLTDFPRTETPQPLSTRCELNISAYNITEFS 75

  Fly    48 IVP---RDF-----CKS------------------KALLVIAVCSGLDHFEQRSAIRQTWGNTKS 86
            .:|   :||     |||                  ...|::.:.|..:::::|..:|:||...  
Zfish    76 TLPDHIKDFLLYRHCKSFPMILDVPDKCGGAQNSADVFLLLVIKSSPENYDRREVLRKTWAEE-- 138

  Fly    87 FNYGEFVRLHGHLEGKYLSVMPGRLKLYSMYLSGLDDSLTAKIRIVFILGRSKND-SKRELDKLF 150
                   |||   :|.:                         ||.|||:|.:::. .||.|::|.
Zfish   139 -------RLH---KGVW-------------------------IRRVFIIGTTQSGFEKRRLNRLL 168

  Fly   151 R-ESIQHNDIIQENFVDSYHNLTLKSVMALKHISQSCADRAAFFLKCDDDTFVNVPNLLHFLLGG 214
            : |:.::.||:|.:|.||:.|||||.::.|:.:.:.|.: |.|.|..|||.|.|..|::.:|.| 
Zfish   169 KLENNENKDILQWDFNDSFFNLTLKQILFLEWMDRRCPN-ARFLLNGDDDIFANTFNMIEYLQG- 231

  Fly   215 TIPLYKDTVGYHSRTTYKVKSPWNRLNGSRGLMYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPK 279
                .:|.                  :|.|.|..||...|:..:.:..|.:|:|..:.:...||.
Zfish   232 ----QEDN------------------DGRRHLFAGHLIQNVGPIRNPSSKYYVPVQIQESESYPP 274

  Fly   280 YLSGTGYLMSIDVVKRLYAEALTTSLVHLEDVFVTGICAKKAGIRRRHQ----------PLFNYV 334
            |..|.|:|:|....:.:|..:.:..|:.::||:: |:|.:|||::....          |..|..
Zfish   275 YCGGGGFLLSGFTARTIYNMSHSVILLPIDDVYM-GMCLEKAGLKPTSHFGVRTAGLSVPAENVD 338

  Fly   335 HGKPLCIFKGTITMHPVPLHSMLDAWAFVSNYSIKC 370
            ...| |.::..|.:|....|.:...|..:.|..:||
Zfish   339 KFDP-CYYREIILVHRFLPHMIFVMWNEIQNPDLKC 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 69/268 (26%)
b3gnt3.4NP_001103580.1 Galactosyl_T 126..321 CDD:304462 69/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24800
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.