DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and si:dkey-160o24.3

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_021336785.1 Gene:si:dkey-160o24.3 / 558930 ZFINID:ZDB-GENE-140106-224 Length:459 Species:Danio rerio


Alignment Length:297 Identity:81/297 - (27%)
Similarity:133/297 - (44%) Gaps:61/297 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KNTALIV-PRDFC-------KSKALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHL 99
            ::.|:|: |.|.|       |...:|::|:.:...:||.|.|||:|||.:               
Zfish   160 RDYAIIIDPSDVCNHGPLAKKWAPMLLLAIKTQTANFENREAIRETWGRS--------------- 209

  Fly   100 EGKYLSVMPGRLKLYSMYLSGLDDSLTAKIRIVFILGRSKNDSKRELDKLFRESIQHNDIIQENF 164
             |: :....|:||:               :|.||:||:||  |::..:||..||.::.||:|..|
Zfish   210 -GR-IKTRDGQLKI---------------VRRVFLLGKSK--SRQHEEKLQLESKKYGDILQWEF 255

  Fly   165 VDSYHNLTLKSVMALKHISQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRT 229
            .|::.|||||.|:..:..|:.| ..|.|..|.|||.||..|.:|.:|                :.
Zfish   256 TDAFFNLTLKDVLFWEWFSRRC-PHARFIFKGDDDVFVRTPAVLDYL----------------QA 303

  Fly   230 TYKVKSPWNRLNGSRGLMYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVK 294
            ....:|..:........:.|....|...:....:.:::|...|||. ||.|..|.|.:.|..:..
Zfish   304 VEANESLSDESKNMESFVIGDVIHNAAPIRTNNTKYFIPESFFKGL-YPSYPGGGGVVYSGSLAH 367

  Fly   295 RLYAEALTTSLVHLEDVFVTGICAKKAGIRRRHQPLF 331
            ||...:....|..::||:: |:|.::.|:...|.|.|
Zfish   368 RLLEVSQRVHLFPIDDVYL-GMCLRRLGVYPVHHPAF 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 70/256 (27%)
si:dkey-160o24.3XP_021336785.1 Galactosyl_T 199..401 CDD:328824 69/254 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592625
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.