DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and b3galnt2

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001011210.1 Gene:b3galnt2 / 496641 XenbaseID:XB-GENE-1012156 Length:488 Species:Xenopus tropicalis


Alignment Length:351 Identity:77/351 - (21%)
Similarity:122/351 - (34%) Gaps:101/351 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 HDRKAELSGWEREKPLKIGDYLDQGKNTALIVPRDFCKSKALLVIAVCSGLDHFEQRSAIRQTWG 82
            ||.:..|||                 |...::..|  ......:..|..||..:|....:.   |
 Frog   216 HDPEGLLSG-----------------NVHRVIVND--GGGIFRITTVKEGLLPYEFTEGVE---G 258

  Fly    83 NTKSFNYGEFVRLHGHLEGK-YLSVMPGRLKLYSMYLSGLDDSLTAKIRIVFILGRSKNDSKREL 146
            ....|.|    .:|   ||: .|:.:..|.:...::|:.|:                |.|:    
 Frog   259 IAGGFTY----TIH---EGEALLNTLETRPERIQIHLAALE----------------KEDA---- 296

  Fly   147 DKLFRESIQHNDIIQENFVDSYHNLTLKSVMALKHISQSCADRAA--FFLKCDDDTFVNVPNLLH 209
             .|..||....||:..:.||:|.|:..|    |.:..|..|:..:  |.||.|||.|:::.|:|.
 Frog   297 -LLQEESTTFQDIVFVHVVDTYRNVPSK----LLNFYQWTAEFTSFEFLLKTDDDCFIDIENVLE 356

  Fly   210 FLLGGTIPLYKDTVGYHSRTTYKVKSPWN--RLNGSRGLMYGHKFCNMKTVDDVKSPWYMPYYMF 272
            .:.              .:...|..:.|.  |||.:               .|....|....|: 
 Frog   357 KIA--------------HKQLQKENTWWGNFRLNWA---------------VDRTGKWQELEYL- 391

  Fly   273 KGAKYPKYLSGTGYLMSIDVVKRLYAEALTTSLVHLEDVFVTGICAKKAGIRRRHQPLFNYVHGK 337
             ...||.:..|:||::|.|:|:.|.:.:........|||.: ||.....|..|       |....
 Frog   392 -SPAYPAFACGSGYVISQDIVQWLASNSQRLKTYQGEDVSM-GIWMSAIGPSR-------YQDSH 447

  Fly   338 PLCIFKGTITMHPVPLHS---MLDAW 360
            .||..|....|...|.::   :|:.|
 Frog   448 WLCEKKCEAGMLSSPQYTPQELLELW 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 59/261 (23%)
b3galnt2NP_001011210.1 Galactosyl_T 292..445 CDD:304462 49/216 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.