DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and b3galt2

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_996984.1 Gene:b3galt2 / 404633 ZFINID:ZDB-GENE-040426-2078 Length:437 Species:Danio rerio


Alignment Length:325 Identity:100/325 - (30%)
Similarity:147/325 - (45%) Gaps:76/325 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KSKALLVIAVCSGLDHFEQRSAIRQTWGN-TKSFNYGEFVRLHGHLEGKYLSVMPGRLKLYSMYL 118
            :|...||:.:.:.....|.|:|||||||| :.:..|| ||||                       
Zfish   160 ESSPFLVLLIAAEPRQLEARNAIRQTWGNESVAMGYG-FVRL----------------------- 200

  Fly   119 SGLDDSLTAKIRIVFILGRSKND-SKRELDKLFRESIQHNDIIQENFVDSYHNLTLKSVMALKHI 182
                          |:|||..|. .:..:|:   ||:||:||||::|:|:|:|||:|::|.:..:
Zfish   201 --------------FLLGRIPNAYPQSSVDE---ESLQHHDIIQQDFLDTYYNLTIKTLMGMSWV 248

  Fly   183 SQSCADRAAFFLKCDDDTFVNVPNLLHFLL-GGTIPLYKDTVGYHSRTTYKVKSPWNRLNGSRGL 246
            ::.| ..|.:.:|.|.|.|||...|:..|| ..|.|......||                    |
Zfish   249 ARYC-PHARYVMKTDSDMFVNTEYLIQKLLKPNTAPRQNYFTGY--------------------L 292

  Fly   247 MYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEALTTSLVHLEDV 311
            |.|:.....|     .|.||||..::...:||.:.|||||:.|.|:..::|..:|:...:|||||
Zfish   293 MRGYAPNRNK-----DSKWYMPPELYSIERYPIFCSGTGYVFSGDMAAKIYNASLSIRRLHLEDV 352

  Fly   312 FVTGICAKKAGIRRRHQP---LFNYVH-GKPLCIFKGTITMHPVPLHSMLDAWAFV-SNYSIKCL 371
            :| |||..|..|.....|   |||:.. ....|.:...||.|....:.::..|..: ||....||
Zfish   353 YV-GICLAKLRIDPVPPPNEFLFNHWRVSYSSCKYSHLITSHQFQPNELMKYWNHLQSNKHNPCL 416

  Fly   372  371
            Zfish   417  416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 84/259 (32%)
b3galt2NP_996984.1 Galactosyl_T 177..369 CDD:250845 84/259 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24800
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.