DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and beta3GalTII

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_610399.1 Gene:beta3GalTII / 35848 FlyBaseID:FBgn0033315 Length:382 Species:Drosophila melanogaster


Alignment Length:319 Identity:81/319 - (25%)
Similarity:133/319 - (41%) Gaps:77/319 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LVIAVCSGLDHFEQRSAIRQTW----GNTKSFNY--GEFVRL-----HGHLEGKYLSVMPGRLKL 113
            |::.|.|...:.::|:|:|:||    |.:.:..|  .|.:.|     .|||:.:.::....||:.
  Fly    51 LMVLVLSAPHNADERNAMRRTWLANAGQSIAQPYLPEELIYLPTFNAQGHLQVELVAEQASRLRQ 115

  Fly   114 YSMYLSGLDDSLT---------AKIRIVFILGRSKNDSKRELDKLFRESIQHNDIIQEN-FVDSY 168
            |:.:...|   ||         ..::.||.:| :.:.|...|.:|.:|..|:||::..| ..|:|
  Fly   116 YTNWQQSL---LTEGPPRTKRLITVKHVFSIG-TLDLSSSALAELEKEQNQNNDLLLLNRHHDTY 176

  Fly   169 HNLTLKSVMAL----KHISQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPL------YKDTV 223
            .|||.|.:.:|    :|...|      :.||.||||:|.:.:|::.|:.....|      |:|.|
  Fly   177 KNLTAKLMQSLYILRRHYEFS------YMLKVDDDTYVKLDSLVNTLVSYDRKLLRKRSEYRDHV 235

  Fly   224 ------GY-HSRTTYKVKSPWNRLNGSRGLMYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYL 281
                  || :.|:|.|.|..|...:                           ||:.|  .|..|.
  Fly   236 LPQLYWGYFNGRSTIKTKGQWKESS---------------------------YYLSK--NYLPYA 271

  Fly   282 SGTGYLMSIDVVKRLYAEALTTSLVHLEDVFVTGICAKKAGIRRRHQPLFNYVHGKPLC 340
            .|.||::|..:...:...:...|....|||.|....|....:.|.|.|.|:..:....|
  Fly   272 LGGGYVLSRSLCDYIVNNSQLLSHYGSEDVSVGTWLAPLRHVYRWHDPRFDTSYAPRKC 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 75/294 (26%)
beta3GalTIINP_610399.1 Galactosyl_T 125..319 CDD:304462 58/229 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465005
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.