DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and brn

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster


Alignment Length:323 Identity:82/323 - (25%)
Similarity:143/323 - (44%) Gaps:81/323 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PVPDVHDRKAELSGWEREKPLKIGDYLDQGKNTALIVPRDFCKSKALLVIAVCSGLDHFEQRSAI 77
            |:.|.....:..||.::...|::..:..:       ||.|   ..|.|.:.:.|.:.:..:|.||
  Fly    43 PLNDDTGSGSASSGLDKFAYLRVPSFTAE-------VPVD---QPARLTMLIKSAVGNSRRREAI 97

  Fly    78 RQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGRLKLYSMYLSGLDDSLTAKIRIVFILGRSKNDS 142
            |:|||                .||::..|                     .:|.||:||.:: ||
  Fly    98 RRTWG----------------YEGRFSDV---------------------HLRRVFLLGTAE-DS 124

  Fly   143 KRELDKLFRESIQHNDIIQENFVDSYHNLTLKSVMALKHISQSCADRAAFFLKCDDDTFVNVPNL 207
            :::   :..||.:|.||:|..|.|:|.|.|||:::.::..|.. .:|:.|:|..|||.:|:..|:
  Fly   125 EKD---VAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQ-FNRSEFYLFVDDDYYVSAKNV 185

  Fly   208 LHFLLGGTIPLYKDTV--GYHSRTTYKVKSPWNRLNGSRGLMYGHKFCNMKTVDDVKSPWYMPYY 270
            |.||..|......:.:  |:..:|     ||..           |||          |.||:...
  Fly   186 LKFLGRGRQSHQPELLFAGHVFQT-----SPLR-----------HKF----------SKWYVSLE 224

  Fly   271 MFKGAKYPKYLSGTGYLMSIDVVKRLYAEALTTSLVHLEDVFVTGICAKKAGIRRRHQPLFNY 333
            .:...::|.|::...:::|...:::|||.::...|...:||:: ||.|.||||..:|...|.:
  Fly   225 EYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVYL-GIVALKAGISLQHCDDFRF 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 70/258 (27%)
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 70/258 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465008
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24800
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - P PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
87.750

Return to query results.
Submit another query.