DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and B3gnt9

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_008770778.1 Gene:B3gnt9 / 291958 RGDID:1310170 Length:398 Species:Rattus norvegicus


Alignment Length:395 Identity:97/395 - (24%)
Similarity:143/395 - (36%) Gaps:117/395 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PRPVPDVHDRKAEL--------SGWEREKPL--------KIGDYL---DQGKNTALIVPRDFCKS 56
            |||.|.  .|..||        ..:|.|.|:        ....||   ||.:...||.....|.|
  Rat    47 PRPTPG--RRALELPNTAHAAPPAYEGETPVPPTPTDPFDFRRYLRAKDQRRFPLLINQPRKCHS 109

  Fly    57 KAL------LVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGRLKLYS 115
            ...      |:|||.|....||:|.|:|||||            ..|.::|              
  Rat   110 DGASGGSLDLLIAVKSVAADFERREAVRQTWG------------AEGRVQG-------------- 148

  Fly   116 MYLSGLDDSLTAKIRIVFILGRSKNDSK---------RELDKLFRESIQHNDIIQENFVDSYHNL 171
                       |.:|.||:||..|....         |.|  |..||..:.||:...|.|::.||
  Rat   149 -----------ALVRRVFLLGVPKGAGSGGAGTRTHWRAL--LEAESRAYADILLWAFEDTFFNL 200

  Fly   172 TLKSVMALKHISQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSP 236
            |||.:..|...|..|.| ..|..|.|.|.||:|.|||.||                    :.:.|
  Rat   201 TLKEIHFLSWASAFCPD-VHFVFKGDADVFVHVRNLLQFL--------------------EPRDP 244

  Fly   237 WNRLNGSRGLMYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEAL 301
                  ::.|:.|......:.:....|.:::|..::....||.|..|.|:::|...:.||.....
  Rat   245 ------AQDLLAGDVIVQARPIRARASKYFIPQAVYGLPVYPAYAGGGGFVLSGATLHRLAHACT 303

  Fly   302 TTSLVHLEDVFVTGICAKKAGIRRRHQPLFN-----------YVHGKPLCIFKGTITMHPVPLHS 355
            ...|..::|||: |:|.::..:.....|.|.           ::.....|.::..:.:|.:   |
  Rat   304 QVELFPIDDVFL-GMCLQRLRLTPEPHPAFRTFGISQPSAAPHLRTFDPCFYRELVVVHGL---S 364

  Fly   356 MLDAW 360
            ..|.|
  Rat   365 AADIW 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 66/265 (25%)
B3gnt9XP_008770778.1 Galactosyl_T 131..330 CDD:304462 66/265 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.