DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and B3galnt2

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001138323.1 Gene:B3galnt2 / 291212 RGDID:1306946 Length:504 Species:Rattus norvegicus


Alignment Length:262 Identity:61/262 - (23%)
Similarity:93/262 - (35%) Gaps:52/262 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 RSAIRQTWGNTKSFNYGEFVRLHGHLEGK-------YLSVMPGRLKLYSMYLSGLDDSLTAKIRI 131
            |..:....|..:....||....|..:||.       ..:|..|...|.|:|  .....|...|| 
  Rat   242 RVTVNDGGGVLRVLTAGEGALPHEFMEGVEGVAGGFIYTVQEGDALLRSLY--SRPQRLVDHIR- 303

  Fly   132 VFILGRSKNDSKRELDKLFRESIQHNDIIQENFVDSYHNLTLKSVMALKHISQSCADRAAFFLKC 196
                     |.:.|...|.:||..::||:..:.||:|.|:..|.:...:...:|.:  .:..||.
  Rat   304 ---------DLQVEDALLQKESSIYDDIVFVDVVDTYRNVPAKLLNFYRWTVESTS--FSLLLKT 357

  Fly   197 DDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSPWNRLNGSRGLMYGHKFCNMKTVDDV 261
            |||.::                  |.....:|...|      .|:|. ...:|:...|...  |.
  Rat   358 DDDCYI------------------DLEAVFNRIAQK------NLDGP-NFWWGNFRLNWAV--DR 395

  Fly   262 KSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEALTTSLVHLEDVFVTGICAKKAGIRRR 326
            ...|....|  ....||.:..|:||::|.|:|..|...:........|||.: ||.....| .:|
  Rat   396 TGKWQELEY--PSPAYPAFACGSGYVISKDIVDWLAGNSGRLKTYQGEDVSM-GIWMAAIG-PKR 456

  Fly   327 HQ 328
            ||
  Rat   457 HQ 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 61/262 (23%)
B3galnt2NP_001138323.1 Galactosyl_T 309..459 CDD:304462 44/183 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.