DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and B3gnt3

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001099538.1 Gene:B3gnt3 / 290638 RGDID:1305151 Length:378 Species:Rattus norvegicus


Alignment Length:350 Identity:82/350 - (23%)
Similarity:139/350 - (39%) Gaps:95/350 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RDF----------CKSKALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLS 105
            |||          |...|.|::|:.|...::.:|..:|.||...:        |:.|        
  Rat    87 RDFAVLREPKATKCAQPAFLLLAIKSSPANYGRRQVLRTTWARER--------RVRG-------- 135

  Fly   106 VMPGRLKLYSMYLSGLDDSLTAKIRIVFILGRSKNDSK-RELDKLFR-ESIQHNDIIQENFVDSY 168
                                 |.:|.:|::|..::..: |:.::|.. |:..:.||:|.:|.||:
  Rat   136 ---------------------ASLRRLFLVGSDRDPQQARKFNRLLELEAKAYGDILQWDFHDSF 179

  Fly   169 HNLTLKSVMALKHISQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKV 233
            .|||||.|:.|:.....|.: |:|.|..|||.|.:..|::.:|.|                    
  Rat   180 FNLTLKQVLFLEWQRTHCTN-ASFVLNGDDDVFAHTDNMVTYLQG-------------------- 223

  Fly   234 KSPWNRLNGSRGLMYGHKFCNMKTVDDVKSPW---YMPYYMFKGAKYPKYLSGTGYLMSIDVVKR 295
            :.|      .:.|..||...|   |..::.||   ::|..:....|||.|..|.|:|:|...:..
  Rat   224 RDP------DQHLFVGHLIQN---VGPIRVPWSKYFIPTLVTAEDKYPPYCGGGGFLLSRFTMAA 279

  Fly   296 LYAEALTTSLVHLEDVFVTGICAKKAGIR-RRHQ--------PLFNYVHGKPLCIFKGTITMHPV 351
            |:..|....:..::|||: |:|.::.|:. ..|.        |....|.....|.::..:.:|..
  Rat   280 LHRAARVLPIFPIDDVFL-GMCLQQQGLAPGAHSGVRTAGVLPPSPRVSSFDPCFYRDLLLVHRF 343

  Fly   352 PLHSMLDAWAFVSNYSIKC---LPP 373
            ....||..|..:|...:.|   .||
  Rat   344 LPFEMLLMWDALSRPQLACGRQSPP 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 63/270 (23%)
B3gnt3NP_001099538.1 Galactosyl_T 119..308 CDD:419759 62/256 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12332
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.