DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and B3gnt4

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001099408.1 Gene:B3gnt4 / 288752 RGDID:1309612 Length:349 Species:Rattus norvegicus


Alignment Length:338 Identity:88/338 - (26%)
Similarity:150/338 - (44%) Gaps:80/338 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KNTALIVPRDFCKSKALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVM 107
            :|.::::....|.....|::.:.|...|.|||:|||.|||...|:..|.                
  Rat    77 RNFSILLEPSECARDIFLLLVIKSQPAHIEQRAAIRSTWGRGGSWARGR---------------- 125

  Fly   108 PGRLKLYSMYLSGLDDSLTAKIRIVFILGRSKNDSKRELDKLFRESIQHNDIIQENFVDSYHNLT 172
                                ::::||:||.:......:|  |..||.|.:||:|.:|.:.:.|||
  Rat   126 --------------------QLKLVFLLGVAGPVPPAQL--LAYESWQFDDILQWDFAEDFFNLT 168

  Fly   173 LKSVMALKHISQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSPW 237
            ||.:...:.|:.:|. :|.|.||.|||.|::|||:|.||.|                       |
  Rat   169 LKELHVQRWIAAACT-QAHFILKGDDDVFIHVPNVLEFLEG-----------------------W 209

  Fly   238 NRLNGSRGLMYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEALT 302
               :.::.|:.|......:...:.|..:::|:.|::...||.|..|.||:||...|:.|:.....
  Rat   210 ---DPAQDLLVGDVIRLARPNRNTKVKYFIPFSMYRARHYPPYAGGGGYVMSQATVRHLHTAMEE 271

  Fly   303 TSLVHLEDVFVTGICAKKAGIRRRH----------QPLFNYVHGKPLCIFKGTITMHPVPLHSML 357
            ..|..::|||| |:|.:|.|:...|          |||    :.:..|:::|.:.:|.:....|.
  Rat   272 AELFPIDDVFV-GMCLRKLGVTPIHHAGFKTFGIQQPL----NPRDPCLYRGLLLVHRLSPLEMW 331

  Fly   358 DAWAFVSNYSIKC 370
            ..||.|::..::|
  Rat   332 TMWALVTDERLEC 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 72/266 (27%)
B3gnt4NP_001099408.1 Galactosyl_T 106..295 CDD:419759 71/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H81939
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.