DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and B3galt5

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001099357.1 Gene:B3galt5 / 288161 RGDID:1306727 Length:308 Species:Rattus norvegicus


Alignment Length:328 Identity:90/328 - (27%)
Similarity:135/328 - (41%) Gaps:90/328 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LIVPRDFCKSK-ALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGR 110
            |.:|...||.| ..||:.|.|.......|.|||:|||...|            ::|:        
  Rat    43 LQLPEIDCKQKPPFLVLLVTSSHKQLAARMAIRKTWGRETS------------VQGQ-------- 87

  Fly   111 LKLYSMYLSGLDDSLTAKIRIVFILGRSKNDSKRELDKLFRESIQHNDIIQENFVDSYHNLTLKS 175
                             .:|..|:||.|  ||..::|....||.||.||||::|.|:|.|||||:
  Rat    88 -----------------PVRTFFLLGSS--DSTEDMDATALESEQHRDIIQKDFKDAYFNLTLKT 133

  Fly   176 VMALKHISQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDT---VGYHSRTTYKVKSPW 237
            :|.::.:...| .:.|:.:|.|.|.||||..|...||...    |.|   .||.....:.::..:
  Rat   134 MMGMEWVYHFC-PQTAYVMKTDSDMFVNVGYLTELLLKKN----KTTRFFTGYIKPHDFPIRQKF 193

  Fly   238 NRLNGSRGLMYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEALT 302
            |:                         |::..:.:...:||.:.|||||:.|.||..::|..:.:
  Rat   194 NK-------------------------WFVSKFEYPWDRYPPFCSGTGYVFSSDVAIQVYNVSES 233

  Fly   303 TSLVHLEDVFVTGICAKKAGIRRRHQPLFNYVHGK----------PLCIFKGTITMHPVPLHSML 357
            ...:.|||||| |:|..|..||...      :|.|          .:|.|:..:..|.:....:|
  Rat   234 VPFIKLEDVFV-GLCLAKLKIRPEE------LHTKQTFFPGGLRFSVCRFQKIVACHFMKPQDLL 291

  Fly   358 DAW 360
            ..|
  Rat   292 TYW 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 74/259 (29%)
B3galt5NP_001099357.1 Galactosyl_T 69..259 CDD:304462 74/265 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12332
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.