DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and b3gnt7

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_958451.1 Gene:b3gnt7 / 286748 ZFINID:ZDB-GENE-021210-4 Length:418 Species:Danio rerio


Alignment Length:324 Identity:82/324 - (25%)
Similarity:133/324 - (41%) Gaps:78/324 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 CKSKALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGRLKLYSMYL 118
            |..:..|:|.:.|.:..|::|..||:|||..:..|            ||                
Zfish   149 CSGEIDLLIVIKSVITQFDRREVIRKTWGKEQVLN------------GK---------------- 185

  Fly   119 SGLDDSLTAKIRIVFILGRSKN-DSKRELDKLFR-ESIQHNDIIQENFVDSYHNLTLKSVMALKH 181
                     :|:.:|:||:|.| :.:....||.. |...:.|.:|.:|:||:.|||||.:..||.
Zfish   186 ---------RIKTLFLLGKSSNLEERANHQKLLEYEDYIYGDTLQWDFMDSFFNLTLKEIHFLKW 241

  Fly   182 ISQSCADRAAFFLKCDDDTFVNVPNLLHFL-LGGTIPLYKDTVGYHSRTTYKVKSPWNRLNGSRG 245
            .|..| .:..:..|.|||.||:|||:..:| :.|.:   ||                        
Zfish   242 FSSYC-PKTQYIFKGDDDVFVSVPNIFEYLEISGNL---KD------------------------ 278

  Fly   246 LMYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEALTTSLVHLED 310
            |..|......|.:...::.:|:|..::....||.|..|.|:||...:.::||....|..|..::|
Zfish   279 LFVGDVLFKAKPIRKEQNKYYIPQALYNKTLYPPYAGGGGFLMDGALARKLYGACETLELYPIDD 343

  Fly   311 VFVTGIC---AKKAGIRRRHQPLFNYVHGKPL------CIFKGTITMHPVPLHSMLDAWAFVSN 365
            ||: |:|   .:...|:......|..|..|..      |.||..|.:|.:....::..|..|::
Zfish   344 VFL-GMCLEVLQVTPIKHNAFKTFGLVKNKTSRLNREPCFFKSLIVVHKLLPPDLMSMWKLVNS 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 67/262 (26%)
b3gnt7NP_958451.1 Galactosyl_T 167..358 CDD:304462 66/256 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24800
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.