DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and B3gnt6

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001074636.1 Gene:B3gnt6 / 272411 MGIID:3039603 Length:391 Species:Mus musculus


Alignment Length:326 Identity:84/326 - (25%)
Similarity:142/326 - (43%) Gaps:82/326 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGRLKLYSMYLSGLDDS 124
            |::||.|...|:|:|..||:|||..:|::..:.:||                             
Mouse   114 LLLAVKSSPAHYERRELIRRTWGQERSYSGRQVLRL----------------------------- 149

  Fly   125 LTAKIRIVFILGRS-KNDSKRE---LDKLFRESIQHNDIIQENFVDSYHNLTLKSVMALKHISQS 185
                    |::|.| ..::.||   .|.|..|:.::.|::|.:|.|::.|||||.:..|...::.
Mouse   150 --------FLVGTSPPEEAAREPQLADLLSLEAREYGDVLQWDFSDTFLNLTLKHLHLLDWTAEH 206

  Fly   186 CADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSPWNRLNGSRGLMYGH 250
            |.. .:|.|.||||.||:..|:|.||                    :|:||      ...|..|.
Mouse   207 CPG-VSFLLSCDDDVFVHTANVLSFL--------------------EVQSP------EHHLFTGQ 244

  Fly   251 KFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEALTTSLVHLEDVFVTG 315
            .......|.:..|.:::|..:|.|..||.|.||.|:|:|...|:.|.:.|....|..::|.:: |
Mouse   245 LMVGSVPVRESGSKYFVPPQIFPGVAYPAYCSGGGFLLSRYTVRNLRSAAHHVPLFPIDDAYM-G 308

  Fly   316 ICAKKAGIR-RRHQPLFNYVHGKPL----------CIFKGTITMHPVPLHSMLDAWAFVSNYSIK 369
            :|.::||:. ..||.:..:  |..|          |:::..:.:|....:.||..|..:.|.::.
Mouse   309 MCLQQAGLAPSSHQGIRPF--GVQLPNVQRLSLDPCMYRELLLVHRFAPYEMLLMWKALHNPALH 371

  Fly   370 C 370
            |
Mouse   372 C 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 69/261 (26%)
B3gnt6NP_001074636.1 Galactosyl_T 126..318 CDD:304462 68/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847381
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42774
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.