DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and B3gnt6

DIOPT Version :10

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001074636.1 Gene:B3gnt6 / 272411 MGIID:3039603 Length:391 Species:Mus musculus


Alignment Length:51 Identity:16/51 - (31%)
Similarity:23/51 - (45%) Gaps:9/51 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SYQR----PKTGGEKPPTTDTRALPKEKDPTK-----RTAKPADSQRLAEG 113
            :|:|    |..|.||....:....||..:||.     :.|||.:||:...|
Mouse    52 TYRRLSSKPPKGFEKYFPNNKNGGPKNSEPTPSNAEVKEAKPTNSQKTTGG 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:473923 16/51 (31%)
B3gnt6NP_001074636.1 Galactosyl_T 126..318 CDD:473923
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.