DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and B3galt2

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_064409.3 Gene:B3galt2 / 26878 MGIID:1349461 Length:422 Species:Mus musculus


Alignment Length:313 Identity:83/313 - (26%)
Similarity:138/313 - (44%) Gaps:70/313 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 CKSKA-LLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGRLKLYSMY 117
            |:.|: .|::.:.:.....|.|.||||||||.                    ::.|| :::..::
Mouse   146 CQEKSPFLILLIAAEPGQIEARRAIRQTWGNE--------------------TLAPG-IQIIRVF 189

  Fly   118 LSGLDDSLTAKIRIVFILGRSKNDSKRELDKLFRESIQHNDIIQENFVDSYHNLTLKSVMALKHI 182
            |.|:...|...::                ..:..||.|::||||:.::|:|:|||:|::|.:..:
Mouse   190 LLGISIKLNGYLQ----------------HAIQEESRQYHDIIQQEYLDTYYNLTIKTLMGMNWV 238

  Fly   183 SQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTI-PLYKDTVGYHSRTTYKVKSPWNRLNGSRGL 246
            :..| ....:.:|.|.|.|||...|:|.||...: |.:....||                    |
Mouse   239 ATYC-PHTPYVMKTDSDMFVNTEYLIHKLLKPDLPPRHNYFTGY--------------------L 282

  Fly   247 MYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEALTTSLVHLEDV 311
            |.|:.....|     .|.||||..::...:||.:.|||||:.|.|:.::::..:|....:|||||
Mouse   283 MRGYAPNRNK-----DSKWYMPPDLYPSERYPVFCSGTGYVFSGDLAEKIFKVSLGIRRLHLEDV 342

  Fly   312 FVTGICAKKAGIRRRHQP---LFNYVH-GKPLCIFKGTITMHPVPLHSMLDAW 360
            :| |||..|..:.....|   :||:.. ....|.:...||.|......::..|
Mouse   343 YV-GICLAKLRVDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYW 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 72/257 (28%)
B3galt2NP_064409.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..110
Galactosyl_T 165..359 CDD:250845 72/257 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42774
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.870

Return to query results.
Submit another query.