DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and B3gnt4

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_011246501.1 Gene:B3gnt4 / 231727 MGIID:2680208 Length:410 Species:Mus musculus


Alignment Length:343 Identity:95/343 - (27%)
Similarity:151/343 - (44%) Gaps:80/343 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KNTALIVPRDFCKSKALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVM 107
            :|.::::....|.....|::.:.|...|.|||||||.|||...|:..|.                
Mouse   137 RNFSILLEPSECARDTFLLLVIKSQPAHIEQRSAIRSTWGRAGSWARGR---------------- 185

  Fly   108 PGRLKLYSMYLSGLDDSLTAKIRIVFILGRSKNDSKRELDKLFRESIQHNDIIQENFVDSYHNLT 172
                                ::::||:||.:......:|  |..||.|.:||:|.:|.:.:.|||
Mouse   186 --------------------QLKLVFLLGVAGPVPPAQL--LVYESWQFDDILQWDFAEDFFNLT 228

  Fly   173 LKSVMALKHISQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSPW 237
            ||.:...:.|:.:|. :|.|.||.|||.|::|||:|.||.|.. |.....||    ...::..| 
Mouse   229 LKELHVQRWIAAACT-QAHFILKGDDDVFIHVPNVLEFLEGWD-PAQDFLVG----DVIRLARP- 286

  Fly   238 NRLNGSRGLMYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEALT 302
            ||                    :.|..:::|:.|::...||.|..|.||:||...|:.|:.....
Mouse   287 NR--------------------NTKVKYFIPFSMYRARHYPPYAGGGGYVMSQATVRHLHMAMEE 331

  Fly   303 TSLVHLEDVFVTGICAKKAGIRRRH----------QPLFNYVHGKPLCIFKGTITMHPVPLHSML 357
            ..|..::|||| |:|.:|.|:...|          |||    :.:..|::||.:.:|.:....|.
Mouse   332 AELFPIDDVFV-GMCLRKLGVTPIHHAGFKTFGIQQPL----NPRDPCLYKGLLLVHRLSPLEMW 391

  Fly   358 DAWAFVSNYSIKCLPPRK 375
            ..||.|::..:||....|
Mouse   392 TMWALVTDERLKCAATHK 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 76/266 (29%)
B3gnt4XP_011246501.1 Galactosyl_T 166..355 CDD:389837 75/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H81939
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.