DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and B3gnt7

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_660257.2 Gene:B3gnt7 / 227327 MGIID:2384394 Length:397 Species:Mus musculus


Alignment Length:332 Identity:83/332 - (25%)
Similarity:132/332 - (39%) Gaps:82/332 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 CKSKALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGRLKLYSMYL 118
            |.....:::.|.|.:...::|..||||||:                  ::.|...||        
Mouse   126 CAGDVYMLVVVKSVITQHDRREVIRQTWGH------------------EWESAGLGR-------- 164

  Fly   119 SGLDDSLTAKIRIVFILG-RSKNDSKRELDKLFR-ESIQHNDIIQENFVDSYHNLTLKSVMALKH 181
                    ..:|.:|:|| .||.:.:....:|.. |...:.||:|.:|:||:.|||||.:..||.
Mouse   165 --------GAVRTLFLLGTASKQEERTHYQQLLAYEDRLYADILQWDFLDSFFNLTLKEIHFLKW 221

  Fly   182 ISQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSPWNRLNGSRGL 246
            :...|.: ..|..|.|||.|||..|||.||                    ..:.|      ...|
Mouse   222 LDIYCPN-VPFVFKGDDDVFVNPTNLLEFL--------------------SDRQP------QENL 259

  Fly   247 MYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEALTTSLVHLEDV 311
            ..|....:.:.:....:.:|:|..|:..|.||.|..|.|:|||..:.::|:....|..|..::||
Mouse   260 FVGDVLKHARPIRKKDNKYYIPAVMYGKATYPPYAGGGGFLMSGSLARQLHHACDTLELFPIDDV 324

  Fly   312 FVTGICA-------------KKAGIRRRHQPLFNYVHGKPLCIFKGTITMHPVPLHSMLDAWAFV 363
            |: |:|.             |..||.|......|    |..|.::..:.:|.:....:|..|..|
Mouse   325 FL-GMCLEVLGVKPTGHEGFKTFGISRVRSSRMN----KEPCFYRAMLVVHKLLPAELLAMWDLV 384

  Fly   364 SNYSIKC 370
            .: ::.|
Mouse   385 HS-NLTC 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 72/271 (27%)
B3gnt7NP_660257.2 Galactosyl_T 144..338 CDD:304462 68/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42774
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.