DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and C54C8.3

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001361870.1 Gene:C54C8.3 / 183770 WormBaseID:WBGene00008291 Length:226 Species:Caenorhabditis elegans


Alignment Length:205 Identity:50/205 - (24%)
Similarity:92/205 - (44%) Gaps:27/205 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 KIRIVFILGRSKNDSKRELDKLFRESIQHNDIIQENFVDSYHNLTLKSVMALKHISQSCADRAAF 192
            :::.:|::|.:..:.|.: ..:.:|:..:.|||..:..|:|..||.||:..|.: ..|.|.|...
 Worm    13 RMKPLFLVGLTPGEYKMK-KMVMQEAKLYGDIIVVDMNDNYEELTYKSLAILLY-GVSKAPRYQM 75

  Fly   193 FLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSPWNRLNGSRGLMYGHKFCNMKT 257
            ..|.|:|..        |.......||..  |:...|..::              ||.|..:...
 Worm    76 IGKIDEDVM--------FFPDKLTELYDQ--GFIDATPLRI--------------YGLKMQSGAN 116

  Fly   258 V-DDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEALTTSLVHLEDVFVTGICAKKA 321
            : .|....||:|...:..:|:|:|:||..|:::.:..:::.........:.:||||:|||.|:..
 Worm   117 IFRDKTHRWYVPESSYSCSKFPEYVSGMLYMVTWEAAQQIIKSTKYRDFIQVEDVFLTGILAEDL 181

  Fly   322 GIRRRHQPLF 331
            ||..::.|.|
 Worm   182 GISVKNLPEF 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 48/201 (24%)
C54C8.3NP_001361870.1 Galactosyl_T 1..189 CDD:250845 48/201 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I5462
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6776
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4776
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.