DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and bre-5

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001255612.1 Gene:bre-5 / 178142 WormBaseID:WBGene00000270 Length:322 Species:Caenorhabditis elegans


Alignment Length:365 Identity:82/365 - (22%)
Similarity:136/365 - (37%) Gaps:118/365 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLLLMYLSPRPVPDVHDRKAELSGWEREKPLKIGDYLDQGKNTALIVPRDFCK----SKALLVIA 63
            :.||..|.      |.|:..|.|..:...||:..:...:.|.|.  .|:  ||    .:.:::|.
 Worm    28 IFLLWVLG------VVDKFRETSFGDFSWPLETRNLQLRSKFTK--YPQ--CKFSGNGQKIIIII 82

  Fly    64 VCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGRLKLYSMYLSGLDDSLTAK 128
            :.|...:...|.::|:||        |.|..:.|      :.|||                    
 Worm    83 IKSSAKNGPMRESVRKTW--------GVFRMIDG------VEVMP-------------------- 113

  Fly   129 IRIVFILGRSKN-DSKRELDKLFRESIQHNDIIQENFVDSYHNLTLKSVMALKHIS--QSCADRA 190
               :||:||.:| :..|.:|.   ||.::.||:..:.:|||.|.|||...|:.:.:  ..|:...
 Worm   114 ---IFIVGRVENMEIMRRIDV---ESEKYKDILAISDIDSYRNNTLKLFGAIDYAANPNQCSSPD 172

  Fly   191 AFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSPWNRLNGSRGLMY-GHKFCN 254
            ..|| .|||..|::|||:.|                ::|..|.:           |:| |..|..
 Worm   173 FTFL-VDDDYLVHIPNLVKF----------------AKTKQKEE-----------LVYEGFVFDT 209

  Fly   255 MKTVDDVKSPWYMPYYM-------FKGAKYPKYLSGTGYLMSIDVVKRLYAEALTTSLVHLEDVF 312
                    ||:.:..:.       :..::||.|:|.....::.:.:.|.........:...:|||
 Worm   210 --------SPFRLKIHKHSISLNEYPFSRYPPYVSAGAVFLTSETIARFRNSIRKLKMFPFDDVF 266

  Fly   313 VTGICAKKAGIRRRHQPLFNY----------------VHG 336
             |||.||...:...|...|.:                |||
 Worm   267 -TGILAKTVNVAATHNENFIFWCRRVSQKEWDDGVIAVHG 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 62/267 (23%)
bre-5NP_001255612.1 Galactosyl_T 93..282 CDD:304462 62/265 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100261
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.