DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and B3GALNT2

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_006711812.1 Gene:B3GALNT2 / 148789 HGNCID:28596 Length:586 Species:Homo sapiens


Alignment Length:190 Identity:47/190 - (24%)
Similarity:74/190 - (38%) Gaps:37/190 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 ELDKLFR-ESIQHNDIIQENFVDSYHNLTLKSVMALKHISQSCADRAAF--FLKCDDDTFVNVPN 206
            |.|.|.: ||..::||:..:.||:|.|:..|    |.:..:...:..:|  .||.|||.::    
Human   305 EEDALLKEESSIYDDIVFVDVVDTYRNVPAK----LLNFYRWTVETTSFNLLLKTDDDCYI---- 361

  Fly   207 LLHFLLGGTIPLYKDTVGYHSRTTYKVKSPWNRLNGSRGLMYGHKFCNMKTVDDVKSPWYMPYYM 271
                          |.....:|...|      .|:|. ...:|:...|...  |....|....| 
Human   362 --------------DLEAVFNRIVQK------NLDGP-NFWWGNFRLNWAV--DRTGKWQELEY- 402

  Fly   272 FKGAKYPKYLSGTGYLMSIDVVKRLYAEALTTSLVHLEDVFVTGICAKKAGIRRRHQPLF 331
             ....||.:..|:||::|.|:||.|.:.:........|||.: ||.....|.:|....|:
Human   403 -PSPAYPAFACGSGYVISKDIVKWLASNSGRLKTYQGEDVSM-GIWMAAIGPKRYQDSLW 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 46/186 (25%)
B3GALNT2XP_006711812.1 Galactosyl_T 307..457 CDD:304462 45/183 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.